DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir10a and Ir11a

DIOPT Version :9

Sequence 1:NP_001096949.1 Gene:Ir10a / 32067 FlyBaseID:FBgn0083979 Length:609 Species:Drosophila melanogaster
Sequence 2:NP_572795.2 Gene:Ir11a / 32189 FlyBaseID:FBgn0030385 Length:642 Species:Drosophila melanogaster


Alignment Length:426 Identity:89/426 - (20%)
Similarity:169/426 - (39%) Gaps:99/426 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 VTGVDFLVAQMLRERLNFTMLLQQPEK--KYFGERSANGSYNGAIGSIIKDG-LDICLTG----- 273
            :.|:|:.:.|:|.:.|.|.:.|..|::  :.|||.:.:|.:..     :.|| :.|.:.|     
  Fly   273 LAGIDWDLLQLLAKALKFRIQLYMPQEPSQIFGEGNVSGCFRQ-----LADGTVSIAIGGLSGSD 332

  Fly   274 ----FFVKDYLVQQYMDFTVAVYDDELCIYVPKASRIPQSILPIFAVGYDIWLGFVLTAFACALI 334
                .|.|..:..| .:|.:.|..|.   |:   .|:...|||...   .:| |.::.....|::
  Fly   333 KRRSLFSKSTVYHQ-SNFVMVVRRDR---YL---GRLGPLILPFRG---KLW-GVIIVILLLAVL 386

  Fly   335 ---WLTLRVINLKLRIVSLGNQHIVGQALGIMVDTWVVWVRLNLSHLPASYAERMFIGTLCLVSV 396
               ||..|          ||..|.:...|.::|...:...|     ||.....|..:.:..|:::
  Fly   387 STCWLRSR----------LGLSHPIEDLLTVIVGNPIPDHR-----LPGKGFLRYLLASWMLLTL 436

  Fly   397 IFGAIFESSLATVY---IHPLYYKDINTMQELDESGLKVVYKYSSMADDLFFSETSPLFASLNKK 458
            :....:::.|..|.   .|....||:        ||| :...|:.:|:.  :.:..||..:..:.
  Fly   437 VLRCAYQARLFDVLRLSRHRPLPKDL--------SGL-IKDNYTMVANG--YHDFYPLELTCRQP 490

  Fly   459 LSWNRDLRADVIDEVARF---RNKAGVSRYTSLILESS-------HFTLLRKIWVVPECPKYYTI 513
            |.::           |||   :..|...|.|::.|.|:       |..:.|..:|......|:.:
  Fly   491 LDFS-----------ARFERVQRAAPDERLTTIALISNLAYWNHKHPNISRLTFVRQPIYMYHLV 544

  Fly   514 SYVMPRDSPWEDAVNALLLRFLNAGLIV----KWIQDEKSWVDIKMRSNILEADAESELVRVLTI 574
            .| .||......|::..:.:.|:||::.    :::|.|..   .|:.||      :..|:|.:|.
  Fly   545 IY-FPRRFFLRPAIDRKIKQLLSAGVMAHIERRYMQYENK---RKVASN------DPVLLRRITK 599

  Fly   575 GDLQLAF----YVVIGGNLLAFLGFLAEHFRWKLQK 606
            ..:..|:    .|::....:..|..||.....:|::
  Fly   600 SIMNGAYRIHGLVIVLATGMFILELLAGRSNGRLRR 635

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir10aNP_001096949.1 Periplasmic_Binding_Protein_Type_2 220..>294 CDD:304360 20/85 (24%)
TM_PBP1_branched-chain-AA_like 315..>411 CDD:294309 18/101 (18%)
Lig_chan 319..587 CDD:278489 58/291 (20%)
Ir11aNP_572795.2 Periplasmic_Binding_Protein_Type_2 306..>356 CDD:304360 11/55 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.