DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir10a and Ir94c

DIOPT Version :9

Sequence 1:NP_001096949.1 Gene:Ir10a / 32067 FlyBaseID:FBgn0083979 Length:609 Species:Drosophila melanogaster
Sequence 2:NP_732701.2 Gene:Ir94c / 318727 FlyBaseID:FBgn0051423 Length:604 Species:Drosophila melanogaster


Alignment Length:404 Identity:80/404 - (19%)
Similarity:146/404 - (36%) Gaps:127/404 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 VKDYLVQQY---MDFTVAVYDDELCIYVPKASRIPQSILPIFAV-GYDIWLGFVLTAFACALI-- 334
            :|||.:.|:   .:.::.:||..    ..|:......:.|:|.. .:...:.||....||:||  
  Fly   223 LKDYEIVQFAVKYNLSLKLYDQN----ESKSDHFDIQLGPLFITKDFPTQMAFVSPNTACSLIVI 283

  Fly   335 ------WLTLRVINLKLRIVSLGNQHIVGQALGIMVDTWVVW---------VRL-NLSHLPASYA 383
                  |..:.|:: ||.::.|....::..|:.::::|.::|         ||| :|:.|....|
  Fly   284 VPCSPKWRFMDVLH-KLGVLKLIGCLLIAYAVFVLIETLILWLTHRISGREVRLTSLNQLLNPRA 347

  Fly   384 ERMFIG--------------TLCLVSVIFGAIFES----SLATVYIHPLYYKDINTMQELDESGL 430
            .|..:|              .|.||..:||.::.:    :|:.:...|.....:...:||.:|||
  Fly   348 FRGILGLPFPEFRRSSISLRQLFLVISVFGLVYSNFVSCTLSALLTKPAQNPQVRNFKELRDSGL 412

  Fly   431 -KVVYKYS-----SMADDLFFSETSPLFASLNKK----LSWNRDLRADVIDEVARFRNKAGVSRY 485
             .::.||:     ...|..||....|.:..|.||    :.||             |.:......|
  Fly   413 ITIMDKYTHSFIEKHIDPEFFDHVLPHYLILQKKEALRMIWN-------------FNDSYSYVMY 464

  Fly   486 TS---------------LILESSHFTLLRKIWVVPECPKYYTISYVMPRDSPWEDAVNALLLRFL 535
            |:               :..||...|:   .|.:|.       .||:..:|              
  Fly   465 TTTWKSLNTVQKSFDERVFCESESLTI---AWNLPR-------MYVLGNNS-------------- 505

  Fly   536 NAGLIVKWIQDE-----------KSWVD-----IKMRSNILEADAESELVRVLTIGDLQLAFYVV 584
                ::||:...           .||.:     :|:..|:.......|....|:|..|...::::
  Fly   506 ----VLKWMLSRYITYMPQTGIPDSWTEQLPKVLKLLYNVTSPRRIKEGAVPLSIQHLSWIWHLL 566

  Fly   585 IGGNLLAFLGFLAE 598
            ..|..:|.|.|:.|
  Fly   567 FIGESIATLVFIVE 580

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir10aNP_001096949.1 Periplasmic_Binding_Protein_Type_2 220..>294 CDD:304360 5/20 (25%)
TM_PBP1_branched-chain-AA_like 315..>411 CDD:294309 28/132 (21%)
Lig_chan 319..587 CDD:278489 66/344 (19%)
Ir94cNP_732701.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.