DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir10a and Ir7b

DIOPT Version :9

Sequence 1:NP_001096949.1 Gene:Ir10a / 32067 FlyBaseID:FBgn0083979 Length:609 Species:Drosophila melanogaster
Sequence 2:NP_572410.2 Gene:Ir7b / 31690 FlyBaseID:FBgn0029965 Length:655 Species:Drosophila melanogaster


Alignment Length:468 Identity:92/468 - (19%)
Similarity:171/468 - (36%) Gaps:146/468 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 GVDFLVAQMLRERLNFTMLLQQPEKKYFGERSANGSYNGAI-GSIIKDGLDICLTGFFVKDYLVQ 282
            |::..:.|.:.|.||||:.|....|:   |..|....:|.| ..|.....|..|.||..|     
  Fly   235 GIEGALLQFMAENLNFTVGLYWMNKE---EVLATFDESGRIFDEIFGHHADFSLGGFHFK----- 291

  Fly   283 QYMDFTVAVYDDELCIYVPKA-SRIPQSILPIFAV--------------GYD---------IW-- 321
                              |.| |.||.|....:.:              .|:         :|  
  Fly   292 ------------------PSAGSEIPYSQSTYYFMSHIMLVTNLQSAYSAYEKLSFPFTPLLWRA 338

  Fly   322 LGFVLTAFACALIWLTLRVIN---------LKLRIVSLGNQHIVGQALGIMVDTWVVWVRLNLSH 377
            :|.|| ..||.|:.|.:|..:         .:|.::::|         |.:.|.||         
  Fly   339 IGLVL-ILACLLLMLLVRWRHHHELPRNPYYELLVLTMG---------GNLEDRWV--------- 384

  Fly   378 LPASYAERMFIGTLCLVSVIFGAIFESSLATVYIHPLYYKDI--NTMQELDESGLKVVYKYSSMA 440
             |..:..|:.:.|....:::..:.::|.:     :.|..:|.  |..|.:.|    |:.::.:: 
  Fly   385 -PQRFPSRLVLLTWLFATLVLRSGYQSGM-----YQLLRQDTQRNPPQTISE----VLAQHFTI- 438

  Fly   441 DDLFFSETSPLFASLNKKLSWNRDLRADVI-----DEVARF---RNKAGVSRYTSLILESSHFTL 497
             .|.....:.:.|||       .:||.:.:     .|:..|   ..::|.|...:::....:|..
  Fly   439 -QLAEVNEARILASL-------PELRPEQLVYLEGSELQSFPALAQQSGSSARVAILTPYEYFGY 495

  Fly   498 LRKI-------WVVPECPKYYT--ISYVMPRDSPWEDAVNALLLRFLNAGLIVKWIQDEKSWVDI 553
            .||:       .:|.|  :.||  :::.:.|.|.....:|..:......|.:..|.:...|.||.
  Fly   496 FRKVHPMSRRLHLVRE--RIYTQQLAFYVRRHSHLVGVLNKQIQHAHTHGFLEHWTRQYVSAVDE 558

  Fly   554 KMRS-------------------NILEADAESELV----RVLTIGDLQLAFYVVIGGNLLAFLGF 595
            |..|                   ::.|::.:.::.    .||::.:|...|::::..||.|.:.|
  Fly   559 KDESVARIASTSYSTLDGIDGDPSLSESEEDQQVAPVRQNVLSMRELAALFWLILWANLGAVVVF 623

  Fly   596 LAEHF--RWKLQK 606
            :.|..  |.||:|
  Fly   624 VLELLLPRIKLRK 636

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir10aNP_001096949.1 Periplasmic_Binding_Protein_Type_2 220..>294 CDD:304360 18/74 (24%)
TM_PBP1_branched-chain-AA_like 315..>411 CDD:294309 20/129 (16%)
Lig_chan 319..587 CDD:278489 57/329 (17%)
Ir7bNP_572410.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.