DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44422 and CG3565

DIOPT Version :9

Sequence 1:NP_572699.2 Gene:CG44422 / 32063 FlyBaseID:FBgn0265595 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_611942.1 Gene:CG3565 / 37933 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster


Alignment Length:231 Identity:46/231 - (19%)
Similarity:88/231 - (38%) Gaps:64/231 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 DSELEEFETPAR----YRPDSLSALSRATRFTEDE---IKRIYRGF------KAECPT------- 285
            |..|:..|. ||    |..| ::.|::.:.|:.:|   |..:|..|      :|:..|       
  Fly     5 DGSLDTLEN-ARFNYVYMKD-IARLAKDSIFSHNELISIVMLYHKFVLVNGPRAKYMTIQQLSAL 67

  Fly   286 -----GVVKEDTF-KVIYSQFFPQGANPTLYAHYVFNTLDQDHSGIVSFEDFVQGLSILSRGSVE 344
                 .:|..|.. .::|......|:.|.       :.....|   :..|.||:..::.....::
  Fly    68 MELLFEIVDRDLIATIVYRIAHTPGSRPP-------DFFSDKH---IHLESFVRLFTVYFTKDLQ 122

  Fly   345 EKLRWTFSLYD------INGD--GFITREEMTDIVTAIYELMGRLPDECPEEEKIKGKV---EQI 398
            .|:.:.||:||      :||:  ||               .:|:..:...|:|.|:.::   |.:
  Fly   123 LKMEFAFSVYDKSDSKQLNGEQVGF---------------FVGKFFESEDEDESIELRLDMKEML 172

  Fly   399 FQKMDTNRDGVVTLEEFLEACRNDDAISRSMSYTVP 434
            |.|.|.::|..:.::|:.|..|....:........|
  Fly   173 FLKFDLDKDTNIGVDEYYEVVRRQPMLLECFGRVFP 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44422NP_572699.2 FRQ1 254..419 CDD:227455 38/197 (19%)
EFh 310..372 CDD:238008 13/69 (19%)
EFh 346..418 CDD:238008 19/82 (23%)
CG3565NP_611942.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.