DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA10 and Abd-B

DIOPT Version :9

Sequence 1:NP_061824.3 Gene:HOXA10 / 3206 HGNCID:5100 Length:410 Species:Homo sapiens
Sequence 2:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster


Alignment Length:341 Identity:102/341 - (29%)
Similarity:145/341 - (42%) Gaps:82/341 - (24%)


- Green bases have known domain annotations that are detailed below.


Human   128 EPPDGPPPPPQQQPPPPPQ---PPQPAPQATSCSFAQNIKEESSYCLYDSADKCPK----VSATA 185
            :.|.||....||....|..   |.|..|.:.:...:.|::::..   ..:|...|.    |:.|.
  Fly   146 QTPTGPSAQQQQHLTSPHHQQLPQQQTPNSVASGASSNLQQQQQ---QQNAAVAPGQTQIVAPTT 207

Human   186 AELAP-----------------------FPRGPPPDGCALGTSSGVPVPGYFRLSQAY---GTAK 224
            |.::|                       ...||   |....||:.|.   ......||   |..:
  Fly   208 ASVSPSSVSSQKEDINMSIQLAPLHIPAIRAGP---GFETDTSAAVK---RHTAHWAYNDEGFNQ 266

Human   225 GYGSGGGGAQQLGAGPFPAQ--PPGR--GFDLPPALASGSADAA----RKER------------- 268
            .||||....:.:.|.|:|..  |.|:  |.:..|...:.:|.||    ..||             
  Fly   267 HYGSGYYDRKHMFAYPYPETQFPVGQYWGPNYRPDQTTSAAAAAAYMNEAERHVSAAARQSVEGT 331

Human   269 ALDSPPPPTLACGSGGGSQG-DEEAHASSSAAEELSPAPSESSKASPEKDSLGNSKGENAANWLT 332
            :..|..|||.:  |.||.:| ..|.::||.|:..||.........:|           ....|..
  Fly   332 STSSYEPPTYS--SPGGLRGYPSENYSSSGASGGLSVGAVGPCTPNP-----------GLHEWTG 383

Human   333 AKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKK---- 393
            ..|.||||.||:|.||||||||||||.|:::::|.|::|::.||:|||||||||||||.||    
  Fly   384 QVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQR 448

Human   394 -MNRENRIRELTANFN 408
             .|::|.....::|.|
  Fly   449 QANQQNNNNNSSSNHN 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA10NP_061824.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..158 9/32 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..339 35/139 (25%)
Homeobox 339..392 CDD:278475 36/52 (69%)
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 36/52 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7588
eggNOG 1 0.900 - - E1_KOG0487
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414477at33208
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 1 1.000 - - otm40637
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45874
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
66.010

Return to query results.
Submit another query.