DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA10 and tin

DIOPT Version :9

Sequence 1:NP_061824.3 Gene:HOXA10 / 3206 HGNCID:5100 Length:410 Species:Homo sapiens
Sequence 2:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster


Alignment Length:308 Identity:75/308 - (24%)
Similarity:106/308 - (34%) Gaps:91/308 - (29%)


- Green bases have known domain annotations that are detailed below.


Human   135 PPPQQQ--------------------PPPPPQ---------------------PPQPAPQATSCS 158
            |.||||                    ||||.|                     |.|....:.|  
  Fly    93 PIPQQQLHHQHLDDGATTSSSLSPLLPPPPHQLYGGYQDYGMPAHMFQHHHGHPHQSFQHSAS-- 155

Human   159 FAQNIKEESSYCLYDSADKCPKVSATAAELAPFPRGPPPDGCALGTSSGVPVPGYFRLSQAYGTA 223
             |.|:.....|.         ..||||.:                      .|..:..:.|    
  Fly   156 -AYNMSASQFYA---------GASATAYQ----------------------TPATYNYNYA---- 184

Human   224 KGYGSGGGGAQQLGAG------PFPAQPPGRGFDLPPALASGSADAARKERALDSPPPPTLACGS 282
             |.|...|||.....|      |.|...|....||..:....|..|..::..::  |.......:
  Fly   185 -GSGEVYGGATPSAVGIKSEYIPTPYVTPSPTLDLNSSAEVDSLQAPTQKLCVN--PLSQRLMET 246

Human   283 GGGSQGDEEAHASSSAAEELSPAPSESSKASPEKDSL-GNSK-GENAANWLTAKSGRKKRCPYTK 345
            ...|......:.|...|::...:...||::...|:|: |||. |.|:.: ...:..||.|..:::
  Fly   247 ASNSSSLRSIYGSDEGAKKKDNSQVTSSRSELRKNSISGNSNPGSNSGS-TKPRMKRKPRVLFSQ 310

Human   346 HQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKK 393
            .|.||||..|....|||...|..|::.::|:..||||||||||.|.|:
  Fly   311 AQVLELECRFRLKKYLTGAEREIIAQKLNLSATQVKIWFQNRRYKSKR 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA10NP_061824.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..158 13/63 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..339 27/125 (22%)
Homeobox 339..392 CDD:278475 24/52 (46%)
tinNP_524433.1 HOX 301..357 CDD:197696 26/55 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.