DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA10 and Ubx

DIOPT Version :9

Sequence 1:NP_061824.3 Gene:HOXA10 / 3206 HGNCID:5100 Length:410 Species:Homo sapiens
Sequence 2:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster


Alignment Length:469 Identity:118/469 - (25%)
Similarity:156/469 - (33%) Gaps:213/469 - (45%)


- Green bases have known domain annotations that are detailed below.


Human     2 SARKGYLL-----PSPNYPTTMSCSESP---------------AANSFLVDSL------------ 34
            :|.:|:.|     |..|:....:..:||               .|.::..|.|            
  Fly    38 AAYRGFPLSLGMSPYANHHLQRTTQDSPYDASITAACNKIYGDGAGAYKQDCLNIKADAVNGYKD 102

Human    35 ISSGRGEAGGGGGGAGGGGGGGYYAHGGVYLPPAADLPYGLQSCGLFPTLGGKRNEAASPGSGGG 99
            |.:..|..||||||.||||||.                            ||      :.|:|..
  Fly   103 IWNTGGSNGGGGGGGGGGGGGA----------------------------GG------TGGAGNA 133

Human   100 GGGLGPGAHGYGPSPIDLWLDAPRSCRMEPPDGPPPPPQQQPPPPPQPPQPAPQATSCSFAQNIK 164
            .||....|:|                             |..|....|.:|              
  Fly   134 NGGNAANANG-----------------------------QNNPAGGMPVRP-------------- 155

Human   165 EESSYCLYDSADKCPKVSATAAELAPFPRGPPPDGCALGTSSGVPVPGYFRLSQAYGTAKGY--- 226
               |.|..||     :|                 |..|.||.|.||      |...|:|.|.   
  Fly   156 ---SACTPDS-----RV-----------------GGYLDTSGGSPV------SHRGGSAGGNVSV 189

Human   227 --GSGGGGAQQLGAGPFPAQPPGRGFDLPPALASGSADAARKERALDSPPPPTLACGSGGGSQGD 289
              |:|..|..|.|.|               ...:|:|..|.              |...|     
  Fly   190 SGGNGNAGGVQSGVG---------------VAGAGTAWNAN--------------CTISG----- 220

Human   290 EEAHASSSAAEELSPA---------------PSESSKASPEKD---------SLGNSKGENAA-- 328
              |.|.::||..|..|               |.:.:|:....|         .:|....|:.|  
  Fly   221 --AAAQTAAASSLHQASNHTFYPWMAIAGECPEDPTKSKIRSDLTQYGGISTDMGKRYSESLAGS 283

Human   329 ---NWLTAKSGRKK-RCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRM 389
               :||.....|:: |..||::|||||||||..|.||||.||:|::.::.||:||:|||||||||
  Fly   284 LLPDWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRM 348

Human   390 KLKKMNRENRIREL 403
            ||||  ....|:||
  Fly   349 KLKK--EIQAIKEL 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA10NP_061824.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..158 10/68 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..339 29/151 (19%)
Homeobox 339..392 CDD:278475 34/53 (64%)
UbxNP_536752.1 Homeobox 299..352 CDD:395001 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.