powered by:
Protein Alignment HOXA10 and bcd
DIOPT Version :9
Sequence 1: | NP_061824.3 |
Gene: | HOXA10 / 3206 |
HGNCID: | 5100 |
Length: | 410 |
Species: | Homo sapiens |
Sequence 2: | NP_788587.1 |
Gene: | bcd / 40830 |
FlyBaseID: | FBgn0000166 |
Length: | 494 |
Species: | Drosophila melanogaster |
Alignment Length: | 75 |
Identity: | 27/75 - (36%) |
Similarity: | 41/75 - (54%) |
Gaps: | 0/75 - (0%) |
- Green bases have known domain annotations that are detailed below.
Human 325 ENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRM 389
|...:.|..:..|:.|..:|..|..|||:.||...|||..|..::|..:.|...||||||:|||.
Fly 86 EELPDSLVMRRPRRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRR 150
Human 390 KLKKMNRENR 399
:.|..:.:::
Fly 151 RHKIQSDQHK 160
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000007 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.