DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA10 and zen2

DIOPT Version :10

Sequence 1:NP_061824.3 Gene:HOXA10 / 3206 HGNCID:5100 Length:410 Species:Homo sapiens
Sequence 2:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster


Alignment Length:91 Identity:42/91 - (46%)
Similarity:58/91 - (63%) Gaps:1/91 - (1%)


- Green bases have known domain annotations that are detailed below.


Human   321 NSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQ 385
            |.:....|...:::..::.|..::..|.:|||:||..|.||.|.||:|||:.:.||:||||||||
  Fly    28 NVEAAPTATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQ 92

Human   386 NRRMKLKK-MNRENRIRELTANFNFS 410
            |||||||| .||:..|..||.:...|
  Fly    93 NRRMKLKKSTNRKGAIGALTTSIPLS 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA10NP_061824.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..158
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..339 2/17 (12%)
Homeodomain 337..393 CDD:459649 32/55 (58%)
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 32/55 (58%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.