DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA10 and exex

DIOPT Version :9

Sequence 1:NP_061824.3 Gene:HOXA10 / 3206 HGNCID:5100 Length:410 Species:Homo sapiens
Sequence 2:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster


Alignment Length:501 Identity:112/501 - (22%)
Similarity:143/501 - (28%) Gaps:197/501 - (39%)


- Green bases have known domain annotations that are detailed below.


Human    66 PPAADLPYGLQSCGLFPTLGGKRNE------AASPGSGGGGGG---------LGPGA------HG 109
            |||.|...|.....|.|     |::      ||||.......|         |.||.      ..
  Fly    50 PPAQDYDQGSNQSTLSP-----RSQITPSPPAASPTHSAATTGSPVSTYTPALSPGGAQDSSQTE 109

Human   110 YGPSPIDLWLDAPRSCRMEPPDGPPPPPQQQ---------------------------------- 140
            .|.|.....|.||......||...||||..:                                  
  Fly   110 SGQSSQMPLLVAPMPVGTGPPHSHPPPPHPRLYVEGFPPPHHVPHPHPALGTYPLPRLPLMLPAN 174

Human   141 PP--------PPPQPPQPAPQATSCSFAQNIKEESSYCLYDSADKCPKVSATAAELAPFPRGPPP 197
            ||        |||..||||....|.|.|                    ..||...|.|....|..
  Fly   175 PPGVPSGAAAPPPVSPQPAANHLSHSGA--------------------TMATTTLLPPAQSQPKK 219

Human   198 DGC---ALGTS---SGVPVP---------------------GYFRLSQAYGTAKGYGSGGGGAQQ 235
            ..|   .|..|   ||.|.|                     .:...|.|...|:...|..||..:
  Fly   220 SFCIDALLAKSQHQSGEPQPIIVDDRLAALHYARDQAELNHAFVTASNAAAAAQAAASAAGGISE 284

Human   236 LGA-----------GPFP-----AQPPGRGFDLPPALASGSADAARKERALDS------------ 272
            ..|           .|.|     ::.|.......|.::.|..|..:...||..            
  Fly   285 QEALQRIRDSREYDSPSPDGMSRSESPTSSHRSSPPISPGCEDQQQPHGALHPQHLSMRMSDFHD 349

Human   273 ------PP-----PPTLACGSGGG-----SQGDEEAHASSSAAEELSPAPSESS----------- 310
                  ||     |......:||.     :||....|.....:.:..|.|...:           
  Fly   350 EFKKPIPPHSPIRPQDFPLYAGGHPYQLLAQGGSAFHRPLDPSGKPIPIPMGHNFMPSQLQFEFL 414

Human   311 -------------KASPEKDSLGNSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLT 362
                         .|.|....||.:              |:.|..:|..|.|||||:|..|.||:
  Fly   415 ARAGMLHHRIPELAAYPHHAILGKT--------------RRPRTAFTSQQLLELEKQFKQNKYLS 465

Human   363 RERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFN 408
            |.:|.|::..:.|::.||||||||||||.|:..:..:..:..|..|
  Fly   466 RPKRFEVASGLMLSETQVKIWFQNRRMKWKRSKKAQQEAKERAKAN 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA10NP_061824.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..158 29/131 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..339 28/185 (15%)
Homeobox 339..392 CDD:278475 28/52 (54%)
exexNP_648164.1 Homeobox 442..495 CDD:278475 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.