DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA10 and unpg

DIOPT Version :9

Sequence 1:NP_061824.3 Gene:HOXA10 / 3206 HGNCID:5100 Length:410 Species:Homo sapiens
Sequence 2:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster


Alignment Length:397 Identity:88/397 - (22%)
Similarity:118/397 - (29%) Gaps:168/397 - (42%)


- Green bases have known domain annotations that are detailed below.


Human    56 GYYAH----------GGVYLPPAADLPYGLQSCGLFPTLGGKRNEAASPGSGGGGGGLGPGAHGY 110
            ||:|.          ||.|||.:                                    |..|  
  Fly    91 GYFAQNHERLTHLIAGGCYLPSS------------------------------------PAGH-- 117

Human   111 GPSPIDLWLDAPRSCRMEPPDGPPPPPQQQP-PPPPQPPQPAPQATSCSFAQNIKEESSYCLYDS 174
                               |....|..|.|| ||||.||..|.:                     
  Fly   118 -------------------PAAQQPQAQAQPQPPPPHPPTHALE--------------------- 142

Human   175 ADKCPKVSATAAELAPFPRGPPPDGCALGTSSGVPVPGYFRLSQAYGTAKGY------------- 226
             .:.|.......:....|..|...|.|....|      |.||::...  :.|             
  Fly   143 -KQLPPTLPHPLDTRFLPFNPAAAGVAPTDLS------YRRLAELMN--QDYVHSLSVHARLQHM 198

Human   227 -GSGGGGAQQLGAGPFPAQPPGRGFDLPPALASGSADAARKERALDSPPPPTLACGSGGGSQGDE 290
             .:|.....|...|....|.|     .||...|..|.:..     .||..|.|..|.      ||
  Fly   199 AAAGRMHEDQANPGMAQLQEP-----TPPQAHSSPAKSGS-----HSPMEPALDVGM------DE 247

Human   291 EAHASSSAAEELS--PAP-----------------SESSKASPE--------------KDSLGNS 322
            :...|..:..::|  .:|                 |:|...|.:              |||.||.
  Fly   248 DFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNG 312

Human   323 KGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNR 387
            ...|:       ..|::|..:|..|.||||:||....||:...|.:|:.|:.|::.|||||||||
  Fly   313 SSSNS-------KSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNR 370

Human   388 RMKLKKM 394
            |.|.|::
  Fly   371 RAKWKRV 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA10NP_061824.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..158 14/69 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..339 30/164 (18%)
Homeobox 339..392 CDD:278475 26/52 (50%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 25/50 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.