DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA10 and cad

DIOPT Version :9

Sequence 1:NP_061824.3 Gene:HOXA10 / 3206 HGNCID:5100 Length:410 Species:Homo sapiens
Sequence 2:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster


Alignment Length:292 Identity:78/292 - (26%)
Similarity:124/292 - (42%) Gaps:69/292 - (23%)


- Green bases have known domain annotations that are detailed below.


Human   150 PAPQATSCSFAQNIKEESSYCLYDSADKCPKVSATAAELAPFPRGPPPDGCALGTSSGVPVPGYF 214
            || .:|:.:|.||:...:...:..........|:::|              :.|:||....||..
  Fly    86 PA-SSTADNFVQNVPTSAHQLMQQHHHHHAHASSSSA--------------SSGSSSSGGAPGAP 135

Human   215 RLSQAYGTAKGYGSGGGGAQQLGA---GPFPAQPP-----GRGFDLPPALASGSADAARKERALD 271
            :|::. .::.|.|..|||....||   ||..|.|.     ..|...||...|||        .:.
  Fly   136 QLNET-NSSIGVGGAGGGGGVGGATDGGPGSAPPNHQQHIAEGLPSPPITVSGS--------EIS 191

Human   272 SPPPPTLAC-----------------GSGGGSQGDEEAHASSSAAEELS----PAPSE------- 308
            ||..||.|.                 .:...:......|.:::....:|    .:||:       
  Fly   192 SPGAPTSASSPHHHLAHHLSAVANNNNNNNNNNNSPSTHNNNNNNNSVSNNNRTSPSKPPYFDWM 256

Human   309 ---SSKASPEKDSLGNSKGENAANWLTAKSGR-----KKRCPYTKHQTLELEKEFLFNMYLTRER 365
               :..|.|:.|...:...|:.::.|.| ||:     |.|..||..|.||||||:..:.|:|..|
  Fly   257 KKPAYPAQPQPDLSSSPNLEDLSDLLDA-SGKTRTKDKYRVVYTDFQRLELEKEYCTSRYITIRR 320

Human   366 RLEISRSVHLTDRQVKIWFQNRRMKLKKMNRE 397
            :.|:::::.|::|||||||||||.|.:|.|::
  Fly   321 KSELAQTLSLSERQVKIWFQNRRAKERKQNKK 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA10NP_061824.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..158 3/7 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..339 34/161 (21%)
Homeobox 339..392 CDD:278475 27/52 (52%)
cadNP_001260641.1 Homeobox 295..347 CDD:278475 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.