DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA10 and bsh

DIOPT Version :9

Sequence 1:NP_061824.3 Gene:HOXA10 / 3206 HGNCID:5100 Length:410 Species:Homo sapiens
Sequence 2:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster


Alignment Length:366 Identity:88/366 - (24%)
Similarity:128/366 - (34%) Gaps:109/366 - (29%)


- Green bases have known domain annotations that are detailed below.


Human    72 PYGLQSCGLFPTLGGKRNEAASPGSGGGGGGLGPGAHGYGPSPIDLWLDAPRSCRMEPPDGPPPP 136
            |:.::.. ||..|    |.|::..:.....|:....:.|.|......:.:.||. ....:.|...
  Fly    43 PFSIEHI-LFQNL----NSASNNNNSSDTNGIAANTNNYAPKSSRNAVKSARSA-FAHDNNPHKH 101

Human   137 PQQQPPPPPQPPQPAPQATSCSFAQNIKEESSYCLYD---SADKCPKVSATAAELAPFPRGPPPD 198
            |.|...||...|..:..|::.:.|::.:..|.|...|   |....|:.:..:..           
  Fly   102 PSQHSHPPQSHPPASASASATATARSNQAASGYAGEDYGKSMHSTPRSNHHSRH----------- 155

Human   199 GCALGTSSGVPVPGYFRLSQAYGTAKGYGSGGGGAQQLGAG-----PFPAQPPGRGFDLPPALAS 258
                |||                    :.:|...:||||:|     |.|...|            
  Fly   156 ----GTS--------------------HYNGDQISQQLGSGAAQHPPVPTTQP------------ 184

Human   259 GSADAARKERALDSPPPPTLACGSGGGSQGDEEAHA---------------SSSAAEELSPAPSE 308
                         .||||....|..|.|.|....:|               |.|:....|..|..
  Fly   185 -------------QPPPPPPLNGGSGASNGVLYPNAPYTDHGFLQMTLGYLSPSSGTYKSVDPYF 236

Human   309 SSKAS--------------PEKDSLGNSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNM 359
            .|:||              ||. :||...|.||   |.....||.|..::..|...|||.|....
  Fly   237 LSQASLFGGAPFFGAPGCVPEL-ALGLGMGVNA---LRHCRRRKARTVFSDPQLSGLEKRFEGQR 297

Human   360 YLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKM--NREN 398
            ||:...|:|::.::.|::.|||.||||||||.||.  .|:|
  Fly   298 YLSTPERVELATALGLSETQVKTWFQNRRMKHKKQLRRRDN 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA10NP_061824.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..158 14/68 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..339 34/151 (23%)
Homeobox 339..392 CDD:278475 22/52 (42%)
bshNP_477350.2 Homeobox 278..330 CDD:278475 22/51 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.