DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA10 and Lim3

DIOPT Version :9

Sequence 1:NP_061824.3 Gene:HOXA10 / 3206 HGNCID:5100 Length:410 Species:Homo sapiens
Sequence 2:NP_001260559.1 Gene:Lim3 / 35184 FlyBaseID:FBgn0002023 Length:555 Species:Drosophila melanogaster


Alignment Length:357 Identity:64/357 - (17%)
Similarity:96/357 - (26%) Gaps:139/357 - (38%)


- Green bases have known domain annotations that are detailed below.


Human   133 PPP-------------PPQQQPPPPPQPPQPAPQATSCSFAQNIKEESSYCLYDSADKCPKVSAT 184
            |||             ||||||.|..|...|..|....|...|.::..           |.:...
  Fly     8 PPPLHHHHQHQHQLQHPPQQQPHPHQQLQHPLQQQQHLSAMDNHQQHQ-----------PHIHQQ 61

Human   185 AAELAPFPRGPPPDGCALGTSSGVPVPGYFRLSQAYGTAKGYGSGGGGAQQLGAGP----FPAQP 245
            ..:....|  |.|....|                           .||.||....|    .....
  Fly    62 QQQQQQLP--PTPQASHL---------------------------VGGQQQQQQHPHHNHLAVDQ 97

Human   246 PGRGFDLPPALASGSADAARKERALDSPPP------------------------PTLACGSGGGS 286
            .....:|..||.|       :.|||::..|                        ..|.|....|.
  Fly    98 DDPNPELVLALIS-------RNRALEATIPKCGGCHELILDRFILKVLERTWHAKCLQCSECHGQ 155

Human   287 QGDE---------------EAHASSSAAEELSPAPS----------------------------- 307
            ..|:               :.:.:..:|.::...|:                             
  Fly   156 LNDKCFARNGQLFCKEDFFKRYGTKCSACDMGIPPTQVVRRAQDNVYHLQCFLCAMCSRTLNTGD 220

Human   308 -----ESSKASPEKD-SLGNSKGENAANWLTAKSGRKK-RCPYTKHQTLELEKEFLFNMYLTRER 365
                 |..|...::| ....:||......|......|: |...|..|...|:..:..:....|..
  Fly   221 EFYLMEDRKLICKRDYEEAKAKGLYLDGSLDGDQPNKRPRTTITAKQLETLKTAYNNSPKPARHV 285

Human   366 RLEISRSVHLTDRQVKIWFQNRRMKLKKMNRE 397
            |.::|:...|..|.|::||||||.|.|::.::
  Fly   286 REQLSQDTGLDMRVVQVWFQNRRAKEKRLKKD 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA10NP_061824.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..158 13/37 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..339 25/195 (13%)
Homeobox 339..392 CDD:278475 17/53 (32%)
Lim3NP_001260559.1 LIM1_Lhx3_Lhx4 122..173 CDD:188754 4/50 (8%)
LIM2_Lhx3_Lhx4 181..236 CDD:188762 4/54 (7%)
Homeobox 259..312 CDD:278475 17/52 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.