DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA10 and nub

DIOPT Version :9

Sequence 1:NP_061824.3 Gene:HOXA10 / 3206 HGNCID:5100 Length:410 Species:Homo sapiens
Sequence 2:NP_001097153.1 Gene:nub / 34669 FlyBaseID:FBgn0085424 Length:961 Species:Drosophila melanogaster


Alignment Length:292 Identity:65/292 - (22%)
Similarity:95/292 - (32%) Gaps:89/292 - (30%)


- Green bases have known domain annotations that are detailed below.


Human   133 PPPPPQQQPPPPPQPPQPAPQATSCSFAQNIKEESSYCLYDSADKCPKVSATAAELAPFPRGPPP 197
            |...|||.......|.|..|.:::.|            |..|....|....:..:::.....|.|
  Fly   711 PASSPQQLHHHHHHPLQITPPSSAAS------------LKLSGMLTPSTPTSGTQMSQGTTTPQP 763

Human   198 D---GCALGTSSGVPVP----GYFRLSQAYGTAK------GYGSGGGGAQ--QLGAGPFPAQPPG 247
            .   ..|...::|.|.|    ....|.|...|.|      |:..|..|..  :|....|......
  Fly   764 KTVASAAAARAAGEPSPEETTDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTIS 828

Human   248 RGFD-----------LPPALASGSADAARKERALDSPPPPTLACGSGGGSQGDEEAHASSSAAEE 301
            | |:           |.|.|.....||.|..:|            :||                .
  Fly   829 R-FEALNLSFKNMCKLKPLLQKWLDDADRTIQA------------TGG----------------V 864

Human   302 LSPAPSESSKASPEKDSLGNSKGENAANWLTAKSGRKKRCPYTKHQTL---ELEKEFLFNMYLTR 363
            ..||..:::.::||  .:|..              ||||   |..:|.   .|||.||.|...|.
  Fly   865 FDPAALQATVSTPE--IIGRR--------------RKKR---TSIETTIRGALEKAFLANQKPTS 910

Human   364 ERRLEISRSVHLTDRQVKIWFQNRRMKLKKMN 395
            |...:::..:.:....|::||.|||.|.|::|
  Fly   911 EEITQLADRLSMEKEVVRVWFCNRRQKEKRIN 942

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA10NP_061824.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..158 7/24 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..339 24/136 (18%)
Homeobox 339..392 CDD:278475 19/55 (35%)
nubNP_001097153.1 DUF4472 315..>399 CDD:291409
POU 791..855 CDD:197673 14/64 (22%)
Homeobox 886..939 CDD:278475 19/55 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.