DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment HOXA10 and prd

DIOPT Version :9

Sequence 1:	NP_061824.3	Gene:	HOXA10 / 3206	HGNCID:	5100	Length:	410	Species:	Homo sapiens
Sequence 2:	NP_723721.1	Gene:	prd / 34629	FlyBaseID:	FBgn0003145	Length:	613	Species:	Drosophila melanogaster

Alignment Length:	134	Identity:	35/134 - (26%)
Similarity:	65/134 - (48%)	Gaps:	10/134 - (7%)

- Green bases have known domain annotations that are detailed below.

Human   264 ARKERALDSPPPPTLACGSGGGSQGDEEAHASSSAAEELSPAPSESSKASPEKDSLGNSKGENAA 328
            :|..|..|:|....::  |..||...:...||||...::|.....:.|  |..:.:.:.:.|..
  Fly   147 SRLVRGRDAPLDNDMS--SASGSPAGDGTKASSSCGSDVSGGHHNNGK--PSDEDISDCESEPG- 206

Human   329 NWLTAKSGRKKRC--PYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKL 391
               .|...:::||  .::..|..|||:.|....|.....|.|:::..:||:.::::||.|||.:|
  Fly   207 ---IALKRKQRRCRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARIQVWFSNRRARL 268

Human   392 KKMN 395
            :|.:
  Fly   269 RKQH 272

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
HOXA10	NP_061824.3	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	89..158
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	221..339		16/74 (22%)
		Homeobox	339..392	CDD:278475	17/54 (31%)
prd	NP_723721.1	PAX	27..154	CDD:238076	2/6 (33%)
prd	NP_723721.1	Homeobox	217..269	CDD:278475	15/51 (29%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910