DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA10 and unc-4

DIOPT Version :9

Sequence 1:NP_061824.3 Gene:HOXA10 / 3206 HGNCID:5100 Length:410 Species:Homo sapiens
Sequence 2:NP_001285389.1 Gene:unc-4 / 32757 FlyBaseID:FBgn0024184 Length:588 Species:Drosophila melanogaster


Alignment Length:335 Identity:77/335 - (22%)
Similarity:114/335 - (34%) Gaps:102/335 - (30%)


- Green bases have known domain annotations that are detailed below.


Human    88 RNEAASPGSGGGGGGLGPGAHGYGPSPIDLWLDAPRSCRMEPPDGPPPPPQQQPPPPPQPPQPAP 152
            |:.:.|..|.........|.|..|.||......:...|.| |.:|..|....|            
  Fly    47 RSSSTSSNSIPNAHRTNAGQHLLGGSPSSACSTSVSGCGM-PSEGLHPTAALQ------------ 98

Human   153 QATSCSFAQNIKEESSYCLYDSADKCPKVSATAAELAPFPRGPPPDGCALGTSSGVPVPGYFRLS 217
                              ||          |.||:|||               :||.||.:....
  Fly    99 ------------------LY----------AAAAQLAP---------------NGVRVPPWGPFL 120

Human   218 QAYGTAKGYGSGGGGAQQLGAGPFPAQPPGRGFDLPPA----LASGSADAARKERALDSPPP--- 275
            | :|....:|..         |||..:|   .||...|    .::.:|.||.:..|:::...   
  Fly   121 Q-FGVPGVFGPN---------GPFLGRP---RFDAASAGGHPNSAAAAAAATQMAAVNASNAFAN 172

Human   276 ----PTLACGSGGGSQGDEEAHASSSAA-----------EELSPA--PSESSKASPEKDSLGNSK 323
                ...|..:...:|....|..:|:.|           :.|.||  |||.|...      |...
  Fly   173 LTGLSAAALRNVSAAQTTAVAAVASTVATIQHRLMIGNRQSLPPAGPPSEGSNED------GGFP 231

Human   324 GENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRR 388
            |:...:...||. |:.|..:...|..|||:.|..:.|.....|..::..:.|.:.:|.:||||||
  Fly   232 GDGDDDSSAAKR-RRSRTNFNSWQLEELERAFSASHYPDIFMREALAMRLDLKESRVAVWFQNRR 295

Human   389 MKLKKMNREN 398
            .|::|  ||:
  Fly   296 AKVRK--REH 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA10NP_061824.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..158 13/68 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..339 30/141 (21%)
Homeobox 339..392 CDD:278475 17/52 (33%)
unc-4NP_001285389.1 Homeobox 246..299 CDD:278475 17/52 (33%)
NK <327..>368 CDD:302627
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.