DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA10 and Lim1

DIOPT Version :9

Sequence 1:NP_061824.3 Gene:HOXA10 / 3206 HGNCID:5100 Length:410 Species:Homo sapiens
Sequence 2:NP_572505.1 Gene:Lim1 / 31813 FlyBaseID:FBgn0026411 Length:505 Species:Drosophila melanogaster


Alignment Length:354 Identity:77/354 - (21%)
Similarity:116/354 - (32%) Gaps:133/354 - (37%)


- Green bases have known domain annotations that are detailed below.


Human   126 RMEPPDGPPPPPQQQPPPPPQPPQPAPQATSCS------FAQNIKEESSY--------CLYDSAD 176
            |.|||.|...|                 ...|:      |..|:.|.:.:        ||....|
  Fly    16 RSEPPVGVGDP-----------------CAGCNKPILDKFLLNVLERAWHASCVRCCECLQPLTD 63

Human   177 KCPKVSATAAELAPFPRGPPPDGCALGTSSGVPVPGYFRLSQAYGTAKGYGSGGGGA-------- 233
            ||     .:.|...:.|.                 .:||   .||| |..|.|.|.|        
  Fly    64 KC-----FSRESKLYCRN-----------------DFFR---RYGT-KCSGCGQGIAPSDLVRKP 102

Human   234 ----------------QQLGAGP----------------FPAQPPGRGFDLPPALASGSADAARK 266
                            :||..|.                ...:.|..|.:   :|:.....:|.:
  Fly   103 RDKVFHLNCFTCCICRKQLSTGEQLYVLDDNKFICKDDYLLGKAPSCGHN---SLSDSLMGSASE 164

Human   267 ERALDSPP---PPTLACG--------SGGGSQGDEEAHASSSAAEELSP-APSESSKASPEKDSL 319
            :...|.||   ...|..|        |.||..|..:....|.:.:..:. ..|:......:.|..
  Fly   165 DDDDDDPPHLRATALGLGVLGPNGPDSAGGPLGTSDISVQSMSTDSKNTHDDSDQGSLDGDPDGR 229

Human   320 GNSKGENA----ANWLTAKSGRKKRCPYT--KHQTLELEKEFLFNM--YLTRERRLEISRSVHLT 376
            |:|:.||.    ||      |.|:|.|.|  |.:.||:.|. .||.  ..||..|.::::...|.
  Fly   230 GDSQAENKSPDDAN------GSKRRGPRTTIKAKQLEVLKT-AFNQTPKPTRHIREQLAKETGLP 287

Human   377 DRQVKIWFQNRRMKLKKMNRENRIRELTA 405
            .|.:::||||:|.|      |.|::::|:
  Fly   288 MRVIQVWFQNKRSK------ERRMKQITS 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA10NP_061824.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..158 6/31 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..339 33/173 (19%)
Homeobox 339..392 CDD:278475 20/56 (36%)
Lim1NP_572505.1 LIM1_Lhx1_Lhx5 27..78 CDD:188753 11/72 (15%)
LIM2_Lhx1_Lhx5 86..141 CDD:188761 7/54 (13%)
COG5576 185..324 CDD:227863 38/139 (27%)
Homeobox 250..303 CDD:278475 19/59 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.