DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA10 and Vsx2

DIOPT Version :9

Sequence 1:NP_061824.3 Gene:HOXA10 / 3206 HGNCID:5100 Length:410 Species:Homo sapiens
Sequence 2:NP_001284897.1 Gene:Vsx2 / 31469 FlyBaseID:FBgn0263512 Length:645 Species:Drosophila melanogaster


Alignment Length:154 Identity:37/154 - (24%)
Similarity:55/154 - (35%) Gaps:47/154 - (30%)


- Green bases have known domain annotations that are detailed below.


Human   269 ALDSPPPP-------------------------TLACGSGGGSQGDEEAHASSSAAEELSPAPSE 308
            |:..||||                         :.|.|:|....|              |.||.:
  Fly   158 AVGGPPPPPPMQHHHPHHPHHPLLHAQGFPQLKSFAAGAGTCLPG--------------SLAPKD 208

Human   309 SSKASPEKDSLG-NSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRS 372
            ....|.....:| |||.:.       |..|..|..:|.:|..:||:.|....|.....|..:|..
  Fly   209 FGMESLNGFGVGPNSKKKK-------KKRRHSRTIFTSYQLEKLEEAFKEAHYPDVYAREMLSLK 266

Human   373 VHLTDRQVKIWFQNRRMKLKKMNR 396
            ..|.:.::::||||||.|.:|..:
  Fly   267 TELPEDRIQVWFQNRRAKWRKTEK 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA10NP_061824.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..158
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..339 19/95 (20%)
Homeobox 339..392 CDD:278475 17/52 (33%)
Vsx2NP_001284897.1 Homeobox 233..286 CDD:278475 17/52 (33%)
OAR 556..570 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.