DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1394 and CG11106

DIOPT Version :9

Sequence 1:NP_001285115.1 Gene:CG1394 / 32059 FlyBaseID:FBgn0030277 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_001285116.1 Gene:CG11106 / 32062 FlyBaseID:FBgn0030280 Length:112 Species:Drosophila melanogaster


Alignment Length:175 Identity:46/175 - (26%)
Similarity:63/175 - (36%) Gaps:76/175 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NSFSYWNGQPLNAPVYPQMGDFMQHSAAGAAAPPPLSATAAAPGLGSAGGLGGWPSQGAAQAHSM 67
            |:.|:|:|||:.:||||:|||....:.|                        |:.:....|.||.
  Fly     4 NTLSFWDGQPVTSPVYPRMGDMWNPNTA------------------------GYQNYQHPQNHSH 44

  Fly    68 LPY--AGGAGGMPAAMPGAMPGVMPGAMSGAMPGAMPGAMSCGMPITGAQHIVPPPVDRSIYGDI 130
            ..|  ..|.|.:                         ..|||.||                 ...
  Fly    45 SNYFQRMGMGDI-------------------------RQMSCPMP-----------------NYC 67

  Fly   131 PGRNEPCIDNGEAFCAYNGMDMSMNYGG--------GSASKGGFW 167
            |...||.:|:.:||.||||||::..|||        ||.::|.||
  Fly    68 PQFREPGLDDVDAFYAYNGMDITQAYGGGSGAGHGAGSGARGDFW 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1394NP_001285115.1 PTZ00009 <89..124 CDD:240227 5/34 (15%)
CG11106NP_001285116.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469208
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016633
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.