DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antdh and IRC24

DIOPT Version :9

Sequence 1:NP_572695.2 Gene:antdh / 32058 FlyBaseID:FBgn0026268 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_012302.3 Gene:IRC24 / 854854 SGDID:S000001475 Length:263 Species:Saccharomyces cerevisiae


Alignment Length:259 Identity:63/259 - (24%)
Similarity:119/259 - (45%) Gaps:30/259 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVVTGASSGIGSAIAKDLVLAG--MTVVGLARRVDRVKELQRELPAEKRGKLFALY--CDVGN 67
            :|.::||||.|||..:.|.::...  ..|.|:||....::.||||..|:|     .:|  .|:.:
Yeast     3 KVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADK-----FVYRVLDITD 62

  Fly    68 ESSVNEAFDWIIQKLGAIDVLVNNAGTLQPGYLVDMNPA-----VMQQVLQTNIMGIVLCTQRAV 127
            .|.:....:.|.||.|.:|.:|.|||.|:|...:..:.:     ..:::...|...||......:
Yeast    63 RSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIVSLVALCL 127

  Fly   128 RSMRERKFDGHVVLINSILGHKTMTATEGVAPDVNVYPPSKHAVTALAEGYRQEFFGLGTRIKIT 192
            ..::...|.|::|.::|....|.....       :.|..||.|:...|.....|  ....:::..
Yeast   128 PLLKSSPFVGNIVFVSSGASVKPYNGW-------SAYGCSKAALNHFAMDIASE--EPSDKVRAV 183

  Fly   193 SVSPGVVDTEIVPDSIREAIKDRMLHSEDIAQGV-LY---AIATP--PHVQVHELIIKPLGETM 250
            .::||||||::..| |||.:..:.:..:.:.:.. ||   ::..|  |...:.:|::|.:.:::
Yeast   184 CIAPGVVDTQMQKD-IRETLGPQGMTPKALERFTQLYKTSSLLDPKVPAAVLAQLVLKGIPDSL 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antdhNP_572695.2 YdfG 1..250 CDD:226674 63/257 (25%)
NADB_Rossmann 1..245 CDD:304358 62/252 (25%)
IRC24NP_012302.3 SPR-like_SDR_c 4..255 CDD:187625 63/258 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341280
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.