DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antdh and AT1G10310

DIOPT Version :9

Sequence 1:NP_572695.2 Gene:antdh / 32058 FlyBaseID:FBgn0026268 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_563866.1 Gene:AT1G10310 / 837570 AraportID:AT1G10310 Length:242 Species:Arabidopsis thaliana


Alignment Length:200 Identity:63/200 - (31%)
Similarity:104/200 - (52%) Gaps:16/200 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVVTGASSGIGSAIAKDLVLAGMTVVGLARRVDRVKELQRELPAEKRGKLFALYCDVGNESSV 71
            |..::||.|.|:|.|:|.:|...|.||:|.||..:::..||.||.:.....|  |..||.:.|||
plant    18 RTVLITGVSKGLGRALALELAKRGHTVIGCARSQEKLTALQSELSSSTNHLL--LTADVKSNSSV 80

  Fly    72 NEAFDWIIQKLGAIDVLVNNAGTLQPGYLV-DMNPAVMQQVLQTNIMGIVLCTQRAVRSMRERKF 135
            .|....|::|.|..|::||||||:.....: :::......|:.||:.|:....:..:..|..|| 
plant    81 EEMAHTIVEKKGVPDIIVNNAGTINKNSKIWEVSAEDFDNVMDTNVKGVANVLRHFIPLMLPRK- 144

  Fly   136 DGHVVLINSILGHKTMTATEGVAPDVNVYPPSKHAVTALAEGYRQEFF-GLGTRIKITSVSPGVV 199
            .|.:|.::|..|.   :....|||    |..||.|:..|:....:|.. |:.    :.:::|||:
plant   145 QGIIVNMSSGWGR---SGAALVAP----YCASKWAIEGLSRAVAKEVVEGMA----VVALNPGVI 198

  Fly   200 DTEIV 204
            :||::
plant   199 NTELL 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antdhNP_572695.2 YdfG 1..250 CDD:226674 63/199 (32%)
NADB_Rossmann 1..245 CDD:304358 63/199 (32%)
AT1G10310NP_563866.1 SDR_c 20..>205 CDD:212491 62/197 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1190834at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.