DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antdh and HSD5

DIOPT Version :10

Sequence 1:NP_572695.2 Gene:Antdh / 32058 FlyBaseID:FBgn0026268 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_192740.1 Gene:HSD5 / 826593 AraportID:AT4G10020 Length:389 Species:Arabidopsis thaliana


Alignment Length:203 Identity:50/203 - (24%)
Similarity:87/203 - (42%) Gaps:13/203 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ERWQNRVAVVTGASSGIGSAIAKDLVLAGMTVVGLARRVDRVKELQRELPAEKRGKLFALYCDVG 66
            |..:::|.|:|||||.||..||.:....|..:|.:|||..|::.:..:........:..:..||.
plant    45 ENMEDKVVVITGASSAIGEQIAYEYAKRGANLVLVARREQRLRVVSNKAKQIGANHVIIIAADVI 109

  Fly    67 NESSVNEAFDWIIQKLGAIDVLVNNAGTLQPGYLVDM-NPAVMQQVLQTNIMGIVLCTQRAVRSM 130
            .|..........:...|.:|.|||.|......|..:: :..|...:|..|..|.|..|..|:..:
plant   110 KEDDCRRFITQAVNYYGRVDHLVNTASLGHTFYFEEVSDTTVFPHLLDINFWGNVYPTYVALPYL 174

  Fly   131 RERKFDGHVVLINSILGHKTMTATEGVAPDVNVYPPSKHAVTALAEGYRQEFFGLGTRIKITSVS 195
            .:.  :|.:|:..|:.....:       |.:::|..:|.|:....|..|   |.|...:.||..:
plant   175 HQT--NGRIVVNASVENWLPL-------PRMSLYSAAKAALVNFYETLR---FELNGDVGITIAT 227

  Fly   196 PGVVDTEI 203
            .|.:.:|:
plant   228 HGWIGSEM 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntdhNP_572695.2 Rossmann-fold NAD(P)(+)-binding proteins 1..245 CDD:473865 50/203 (25%)
HSD5NP_192740.1 Rossmann-fold NAD(P)(+)-binding proteins 47..303 CDD:473865 49/201 (24%)
Extensin_2 343..>379 CDD:252669
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.