DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antdh and DHRS11

DIOPT Version :9

Sequence 1:NP_572695.2 Gene:antdh / 32058 FlyBaseID:FBgn0026268 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_077284.2 Gene:DHRS11 / 79154 HGNCID:28639 Length:260 Species:Homo sapiens


Alignment Length:255 Identity:93/255 - (36%)
Similarity:149/255 - (58%) Gaps:15/255 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERWQNRVAVVTGASSGIGSAIAKDLVLAGMTVVGLARRVDRVKELQREL-PAEKRGKLFALYCD 64
            ||||::|:|:|||||.|||:|:|:.||..|:.|||.||.|..::||..|. .|...|.|....||
Human     6 MERWRDRLALVTGASGGIGAAVARALVQQGLKVVGCARTVGNIEELAAECKSAGYPGTLIPYRCD 70

  Fly    65 VGNESSVNEAFDWIIQKLGAIDVLVNNAGTLQPGYLVDMNPAVMQQVLQTNIMGIVLCTQRAVRS 129
            :.||..:...|..|..:...:|:.:||||..:|..|:..:.:..:.:...|::.:.:||:.|.:|
Human    71 LSNEEDILSMFSAIRSQHSGVDICINNAGLARPDTLLSGSTSGWKDMFNVNVLALSICTREAYQS 135

  Fly   130 MRERKF-DGHVVLINSILGHKTMTATEGVAPDVNVYPPSKHAVTALAEGYRQEFFGLGTRIKITS 193
            |:||.. |||::.|||:.||:.:..:.     .:.|..:|:|||||.||.|||.....|.|:.|.
Human   136 MKERNVDDGHIININSMSGHRVLPLSV-----THFYSATKYAVTALTEGLRQELREAQTHIRATC 195

  Fly   194 VSPGVVDTEIV-------PDSIREAIKD-RMLHSEDIAQGVLYAIATPPHVQVHELIIKP 245
            :|||||:|:..       |:......:. :.|..||:|:.|:|.::||.|:|:.::.::|
Human   196 ISPGVVETQFAFKLHDKDPEKAAATYEQMKCLKPEDVAEAVIYVLSTPAHIQIGDIQMRP 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antdhNP_572695.2 YdfG 1..250 CDD:226674 93/255 (36%)
NADB_Rossmann 1..245 CDD:304358 92/253 (36%)
DHRS11NP_077284.2 Mgc4172-like_SDR_c 6..256 CDD:187601 93/255 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143372
Domainoid 1 1.000 154 1.000 Domainoid score I4257
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41560
Inparanoid 1 1.050 188 1.000 Inparanoid score I3916
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45743
OrthoDB 1 1.010 - - D1190834at2759
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - otm40752
orthoMCL 1 0.900 - - OOG6_100320
Panther 1 1.100 - - O PTHR43115
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X367
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1413.810

Return to query results.
Submit another query.