DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antdh and dhrs7b

DIOPT Version :9

Sequence 1:NP_572695.2 Gene:antdh / 32058 FlyBaseID:FBgn0026268 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_012825988.1 Gene:dhrs7b / 779695 XenbaseID:XB-GENE-946473 Length:323 Species:Xenopus tropicalis


Alignment Length:262 Identity:79/262 - (30%)
Similarity:127/262 - (48%) Gaps:32/262 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QNRVAVVTGASSGIGSAIAKDLVLAGMTVVGLARRVDRVKELQRELPAEKRGKLFALY------C 63
            |:.|.|:|||:||:|...||....||..:|...|..:.:|.|.:|| ::.|.|...|:      .
 Frog    49 QDAVVVITGATSGLGRECAKVFYAAGTRLVLCGRSEEGLKNLVQEL-SQMRIKSAQLHKPHMVIF 112

  Fly    64 DVGNESSVNEAFDWIIQKLGAIDVLVNNAGTLQPGYLVDMNPAVMQQVLQTNIMGIVLCTQRAVR 128
            |:.:..:||.|.:.|:...|.:|:|:||||....|.::|...:|.:.|:.||..|.|..|:..:.
 Frog   113 DLSDVEAVNSAANEILHLTGRVDILINNAGISYRGTILDTKVSVDRMVMDTNYFGPVALTKALIP 177

  Fly   129 SM-RERKFDGHVVLINSILGHKTMTATEGVAPDVNVYPPSKHAVTALAEGYRQEFFGLGTRIKIT 192
            || :.|:  ||:|:|:|:.|..::       |..:.|..||||..|..:..|.|....  .|.:|
 Frog   178 SMIKNRR--GHIVVISSVQGKISI-------PFRSAYSASKHATQAFFDCLRAEMSPY--EIDVT 231

  Fly   193 SVSPGVVDTE-----IVPDSIREAIKDRMLHS----EDIAQGVLYAIATPPHVQVHELIIKPLGE 248
            .|:||.:.|.     :..|.....:.|.....    |::||.||.|:..    :..||::..|..
 Frog   232 VVNPGYIKTNLSLNAVTGDGSNYGVMDNNTAEGRTPEEVAQTVLRAVGE----RRKELLVAGLVP 292

  Fly   249 TM 250
            |:
 Frog   293 TL 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antdhNP_572695.2 YdfG 1..250 CDD:226674 78/260 (30%)
NADB_Rossmann 1..245 CDD:304358 77/255 (30%)
dhrs7bXP_012825988.1 11beta-HSD1_like_SDR_c 48..309 CDD:187593 79/262 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.