DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antdh and Rdh8

DIOPT Version :9

Sequence 1:NP_572695.2 Gene:antdh / 32058 FlyBaseID:FBgn0026268 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001162065.1 Gene:Rdh8 / 690953 RGDID:1589829 Length:312 Species:Rattus norvegicus


Alignment Length:275 Identity:78/275 - (28%)
Similarity:124/275 - (45%) Gaps:58/275 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QNRVAVVTGASSGIGSAIAKDL---------VLAGMTVVGLARRVDRVKELQRELPAEKRGK-LF 59
            |.:..:::|.|||||..:|..|         |:|.|..:|       .||.......|..|| |.
  Rat     4 QPQRVLISGCSSGIGLELAVQLAHDPRQRYQVVATMRDLG-------KKEPLEAAAGEALGKTLS 61

  Fly    60 ALYCDVGNESSVNEAFDWIIQKLGAIDVLVNNAGTLQPGYLVDMNPAVMQQVLQTNIMGIVLCTQ 124
            ....||.::.||......|  :.|.:|:||||||....|.|.|::.|.||.|..||..|.|...:
  Rat    62 VAQLDVCSDESVTNCLSHI--EGGQVDILVNNAGVGLVGPLEDLSLATMQNVFNTNFFGAVRLVK 124

  Fly   125 RAVRSMRERKFDGHVVLINSILGHKTMTATEGVAPDVNVYPPSKHAVTALAEGYRQEFFGLGTRI 189
            ..:..|:.|: .||:|:::|::|      .:||..: :||..||.|:    ||:   |..|..::
  Rat   125 AVLPGMKRRR-QGHIVVVSSVMG------LQGVMFN-DVYAASKFAL----EGF---FESLAIQL 174

  Fly   190 K-----ITSVSPGVVDTEI------------VPDSIREAI---KDRMLHSEDIAQGVLYAIATPP 234
            :     |:.|.||.|.|:.            .||:..|.:   :|..|.:   ::.:..::...|
  Rat   175 RQFNIFISMVEPGPVITDFEGKLLAQVSKTEFPDTDPETLGYFRDLYLPA---SRELFRSVGQSP 236

  Fly   235 HVQVHELIIKPLGET 249
            . .|.::|.|.:|.|
  Rat   237 R-DVAQVIAKVIGST 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antdhNP_572695.2 YdfG 1..250 CDD:226674 78/275 (28%)
NADB_Rossmann 1..245 CDD:304358 75/269 (28%)
Rdh8NP_001162065.1 NADB_Rossmann 8..262 CDD:304358 77/271 (28%)
adh_short 8..201 CDD:278532 66/216 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.