DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antdh and Dhrs7

DIOPT Version :9

Sequence 1:NP_572695.2 Gene:antdh / 32058 FlyBaseID:FBgn0026268 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_079798.2 Gene:Dhrs7 / 66375 MGIID:1913625 Length:338 Species:Mus musculus


Alignment Length:230 Identity:74/230 - (32%)
Similarity:112/230 - (48%) Gaps:21/230 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WQNR---------VAVVTGASSGIGSAIAKDLVLAGMTVVGLARR---VDRVKELQRELPAEKRG 56
            ||.|         |..|||||||||..:|..|...|:::|..|||   ::|||....|....|..
Mouse    39 WQGRRPEWELTDMVVWVTGASSGIGEELAFQLSKLGVSLVLSARRAQELERVKRRCLENGNLKEK 103

  Fly    57 KLFALYCDVGNESSVNEAFDWIIQKLGAIDVLVNNAGTLQPGYLVDMNPAVMQQVLQTNIMGIVL 121
            .:..|..|:.:.||...|...::|:.|.||:||||.|..|...:::.|..|.::::..|.:|.|.
Mouse   104 DILVLPLDLTDTSSHEAATKAVLQEFGKIDILVNNGGRSQRSLVLETNLDVFKELINLNYIGTVS 168

  Fly   122 CTQRAVRSMRERKFDGHVVLINSILGHKTMTATEGVAPDVNVYPPSKHAVTALAEGYRQEFFGLG 186
            .|:..:..|.||| .|.:|.:|||.|..:::.:.|       |..||||:.........| .|..
Mouse   169 LTKCVLPHMIERK-QGKIVTVNSIAGIASVSLSSG-------YCASKHALRGFFNALHSE-LGQY 224

  Fly   187 TRIKITSVSPGVVDTEIVPDSIREAIKDRMLHSED 221
            ..|...:|.||.|.::||.::..|.:...|.::.|
Mouse   225 PGITFCNVYPGPVQSDIVKNAFTEEVTKSMRNNID 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antdhNP_572695.2 YdfG 1..250 CDD:226674 74/230 (32%)
NADB_Rossmann 1..245 CDD:304358 74/230 (32%)
Dhrs7NP_079798.2 11beta-HSD1_like_SDR_c 48..308 CDD:187593 71/221 (32%)
adh_short 52..249 CDD:278532 68/205 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.