DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antdh and dhrs7ca

DIOPT Version :9

Sequence 1:NP_572695.2 Gene:antdh / 32058 FlyBaseID:FBgn0026268 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001013557.2 Gene:dhrs7ca / 558764 ZFINID:ZDB-GENE-050320-114 Length:319 Species:Danio rerio


Alignment Length:266 Identity:60/266 - (22%)
Similarity:107/266 - (40%) Gaps:44/266 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QNRVAVVTGASSGIGSAIAKDLVLAGMTVVGLARRVDRVKELQRELPAEK------RGKLFALYC 63
            :|:|.::|.:.|.:|:..||.....|..::......::::.|..:|.::.      ..||..|  
Zfish    44 RNKVVLITDSLSTVGNECAKLFHAGGARLILCGSNWEKLEALAEQLTSQSDPTLTFPPKLVEL-- 106

  Fly    64 DVGNESSVNEAFDWIIQKLGAIDVLVNNAGTLQPGYLVDMNPAVMQQVLQTNIMGIVLCTQRAVR 128
            |.....||.|....|::....:||||.|:.......:..::..:.:.::..|..|.:...:..:.
Zfish   107 DFSGMESVPEVISEILECFCCLDVLVFNSSMKLKAPVHSLSLQMDRLLMDVNYFGPITLVKGFLP 171

  Fly   129 SMRERKFDGHVVLINSILGHKTMTATEGVAPDVNVYPPSKHAVTALAEGYRQEFFGLG------- 186
            |:..|: .||::|:|||.|...|       |....|..|||||.|..|..|.|....|       
Zfish   172 SLISRR-SGHILLVNSIQGKLAM-------PFRTTYAASKHAVQAFFECLRAEVQEYGITVSTIN 228

  Fly   187 -TRIKITS------------------VSPGVVDTEIVPDSIR--EAIKDRMLHSEDIAQGVLYAI 230
             |.||.:|                  ..|||...::..:.:|  .:.|...|.:..:.:..||..
Zfish   229 HTFIKTSSSISKDEITARSMKTDHRQTPPGVSPKDVATELLRTLSSKKKESLMARWVPKAALYVR 293

  Fly   231 ATPPHV 236
            :..|::
Zfish   294 SLFPNL 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antdhNP_572695.2 YdfG 1..250 CDD:226674 60/266 (23%)
NADB_Rossmann 1..245 CDD:304358 60/266 (23%)
dhrs7caNP_001013557.2 11beta-HSD1_like_SDR_c 43..303 CDD:187593 60/266 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.