DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antdh and dhrs11

DIOPT Version :9

Sequence 1:NP_572695.2 Gene:antdh / 32058 FlyBaseID:FBgn0026268 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_012816490.1 Gene:dhrs11 / 496708 XenbaseID:XB-GENE-6048420 Length:255 Species:Xenopus tropicalis


Alignment Length:257 Identity:108/257 - (42%)
Similarity:154/257 - (59%) Gaps:19/257 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERWQNRVAVVTGASSGIGSAIAKDLVLAGMTVVGLARRVDRVKELQREL-PAEKRGKLFALYCD 64
            ||||:.|||:|||||.|||:|:|:.||..||.|||.||.||::::|..|. .|...|.||...||
 Frog     1 MERWKGRVALVTGASVGIGAAVARVLVQHGMKVVGCARSVDKIEKLAAECQSAGYPGTLFPYKCD 65

  Fly    65 VGNESSVNEAFDWIIQKLGAIDVLVNNAGTLQPGYLVDMNPAVMQQVLQTNIMGIVLCTQRAVRS 129
            :.||..:...|..|......:||.:||||..:|..|:.......:.::..|::.:.:||:.|.:|
 Frog    66 LSNEEEILSMFSAIKTLHQGVDVCINNAGLARPEPLLSGKTEGWRTMIDVNVLALSICTREAYQS 130

  Fly   130 MRERKF-DGHVVLINSILGHKTMTATEGVAPDVNVYPPSKHAVTALAEGYRQEFFGLGTRIKITS 193
            |:||.. |||::.|||:|||....|.:     .:.|..:||.||||.|..|||...|.:.|::||
 Frog   131 MKERNIDDGHIININSVLGHIYQCAKQ-----AHFYCATKHTVTALTEAIRQELRELKSHIRVTS 190

  Fly   194 VSPGVVDTEI----------VPDSIREAIKDRMLHSEDIAQGVLYAIATPPHVQVHELIIKP 245
            :|||:|:||.          :..::.::||  .|...|||..||||:.|||||||||:|::|
 Frog   191 ISPGLVETEFAYRCFENDPSIAATLYKSIK--CLDPGDIANAVLYALGTPPHVQVHEMIVRP 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antdhNP_572695.2 YdfG 1..250 CDD:226674 108/257 (42%)
NADB_Rossmann 1..245 CDD:304358 107/255 (42%)
dhrs11XP_012816490.1 Mgc4172-like_SDR_c 1..251 CDD:187601 108/257 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 152 1.000 Domainoid score I4278
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 162 1.000 Inparanoid score I4110
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1190834at2759
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - otm47935
Panther 1 1.100 - - O PTHR43115
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X367
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.160

Return to query results.
Submit another query.