DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antdh and CG7601

DIOPT Version :9

Sequence 1:NP_572695.2 Gene:antdh / 32058 FlyBaseID:FBgn0026268 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_651717.1 Gene:CG7601 / 43502 FlyBaseID:FBgn0027583 Length:326 Species:Drosophila melanogaster


Alignment Length:269 Identity:66/269 - (24%)
Similarity:109/269 - (40%) Gaps:54/269 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WQ------------NRVAVVTGASSGIGSAIAKDLVLAGMTVVGLARRVDRVKELQRELPAEKRG 56
            ||            .:|.::||||||:|.::|.....||..|:..|||...::.::::|.|....
  Fly    39 WQRFQAQKFRNQLPGKVVLITGASSGLGESLAHVFYRAGCRVILAARRTQELERVKKDLLALDVD 103

  Fly    57 KLF---ALYCDVGNESSVNEAFDWIIQKLGAIDVLVNNAGTLQPGYLVDMNPAVMQQVLQTNIMG 118
            ..:   .|..|:...:|:.|....::.....:|:|:||.|......:......|..:|:..|..|
  Fly   104 PAYPPTVLPLDLAELNSIPEFVTRVLAVYNQVDILINNGGISVRADVASTAVDVDLKVMVVNYFG 168

  Fly   119 IVLCTQRAVRSMRERKFDGHVVLINSILGHKTMTATEGVAPDVNVYPPSKHAVTALAEGYRQEFF 183
            .|..|:..:.||.:|. .||:..|:|:.|       :...|....|..||||:.|.|:..|.|. 
  Fly   169 SVALTKALLPSMVKRG-SGHICFISSVQG-------KFAIPQRAAYSASKHAMQAFADSLRAEV- 224

  Fly   184 GLGTRIKITSVSPGVVDTEI-----------------------VPDSIREAIKDRMLHSE----- 220
             ....|.::.||||.:.|::                       .||.:.|.|...:|..|     
  Fly   225 -ANKNINVSCVSPGYIRTQLSLNALTGSGSSYGKVDETTAKGMSPDKLAERILQCILRKEPDIIV 288

  Fly   221 -DIAQGVLY 228
             |:...:.|
  Fly   289 SDVQAKIAY 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antdhNP_572695.2 YdfG 1..250 CDD:226674 66/269 (25%)
NADB_Rossmann 1..245 CDD:304358 66/269 (25%)
CG7601NP_651717.1 11beta-HSD1_like_SDR_c 51..310 CDD:187593 64/257 (25%)
PRK06181 53..314 CDD:235726 64/255 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435162
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.