DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antdh and rdhB

DIOPT Version :9

Sequence 1:NP_572695.2 Gene:antdh / 32058 FlyBaseID:FBgn0026268 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001262831.1 Gene:rdhB / 42614 FlyBaseID:FBgn0038946 Length:248 Species:Drosophila melanogaster


Alignment Length:246 Identity:101/246 - (41%)
Similarity:155/246 - (63%) Gaps:11/246 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WQNRVAVVTGASSGIGSAIAKDLVLAGMTVVGLARRVDRVKELQRELPAEKRGKLFALYCDVGNE 68
            |:|:||||||||.|||:..|.:|..|||.||||||||:.::.|:.::...  ||:||..||:.:|
  Fly     7 WRNKVAVVTGASVGIGATTAIELANAGMVVVGLARRVELIEALRDQVTGV--GKIFARQCDLNDE 69

  Fly    69 SSVNEAFDWIIQKLGAIDVLVNNAGTLQPGYLVDMNPAVMQQVLQTNIMGIVLCTQRAVRSMRER 133
            ..:..||:||.:|..||.||:.|||.|:..:|.:.....::::..||::....|.:.|::.|...
  Fly    70 EQLASAFNWIREKFQAIHVLICNAGILKANFLSESPTKDIKELFDTNVVATASCLREALKHMAAV 134

  Fly   134 KFDGHVVLINSILGHKTMTATEGVAPDVNVYPPSKHAVTALAEGYRQEFFGLGTRIKITSVSPGV 198
            |..||:|::||:|||:   ..|...|..:|||.:|||:|||.:..|||...|...||:||:.||:
  Fly   135 KVRGHIVVMNSVLGHR---IPEVPVPLFSVYPATKHAITALCQTVRQEIHFLKLNIKLTSICPGM 196

  Fly   199 VDTE---IVPDSIREAIKDRMLHSEDIAQGVLYAIATPPHVQVHELIIKPL 246
            |||:   :...::.|..|   |.:.|:|:.||||:.||..|||.::|::.:
  Fly   197 VDTDFLSVYSQAVAELPK---LQARDVAKAVLYALNTPDGVQVEDIILQQM 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antdhNP_572695.2 YdfG 1..250 CDD:226674 101/246 (41%)
NADB_Rossmann 1..245 CDD:304358 101/243 (42%)
rdhBNP_001262831.1 Mgc4172-like_SDR_c 4..244 CDD:187601 101/244 (41%)
YdfG 9..241 CDD:226674 99/239 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I2775
eggNOG 1 0.900 - - E2759_KOG1205
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I2312
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45743
OrthoDB 1 1.010 - - D101130at6960
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - otm51373
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43115
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.980

Return to query results.
Submit another query.