DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antdh and CG3301

DIOPT Version :9

Sequence 1:NP_572695.2 Gene:antdh / 32058 FlyBaseID:FBgn0026268 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001287440.1 Gene:CG3301 / 42528 FlyBaseID:FBgn0038878 Length:250 Species:Drosophila melanogaster


Alignment Length:251 Identity:128/251 - (50%)
Similarity:168/251 - (66%) Gaps:6/251 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERWQNRVAVVTGASSGIGSAIAKDLVLAGMTVVGLARRVDRVKELQRELPAEKRGKLFALYCDV 65
            |.||.||||||||||:|||:|..:|||..||.|||||||...:::::..|||::..:.....|||
  Fly     1 MNRWLNRVAVVTGASAGIGAACCRDLVAKGMVVVGLARREKVLQDIKSSLPADQAARFHTRPCDV 65

  Fly    66 GNESSVNEAFDWIIQKLGAIDVLVNNAGTLQPGYLVD-MNPAVMQQVLQTNIMGIVLCTQRAVRS 129
            .||..|.:.|.||.:.||..||||||||.::...:.| .|.|.::.:|..|::|:..||::...|
  Fly    66 SNEQQVIDTFAWIDRTLGGADVLVNNAGIIRQMNITDPENSADVRAILDVNVLGVTWCTRQWFLS 130

  Fly   130 MRERKF-DGHVVLINSILGHKTMTATEGVAPDVNVYPPSKHAVTALAEGYRQEFFGLGTRIKITS 193
            ::.||. |||||:|||::|| ::.|.||.:  :|:|.|||||:|||.|..||||...||:.||||
  Fly   131 LQRRKVNDGHVVVINSVVGH-SVPAVEGFS--LNMYAPSKHAITALTEILRQEFIKKGTQTKITS 192

  Fly   194 VSPGVVDTEIV-PDSIREAIKDRMLHSEDIAQGVLYAIATPPHVQVHELIIKPLGE 248
            :|||||.|||. ..|..:.....||.|||||..|.|.|.|||.||:.||||||:||
  Fly   193 ISPGVVATEIFEAGSWEQPTGMPMLRSEDIADAVTYCIQTPPTVQIKELIIKPVGE 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antdhNP_572695.2 YdfG 1..250 CDD:226674 128/251 (51%)
NADB_Rossmann 1..245 CDD:304358 124/246 (50%)
CG3301NP_001287440.1 YdfG 1..250 CDD:226674 128/251 (51%)
NADB_Rossmann 1..245 CDD:304358 124/246 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442649
Domainoid 1 1.000 86 1.000 Domainoid score I2775
eggNOG 1 0.900 - - E2759_KOG1205
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I2312
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45743
OrthoDB 1 1.010 - - D101130at6960
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - mtm6354
orthoMCL 1 0.900 - - OOG6_100320
Panther 1 1.100 - - P PTHR43115
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X367
1110.900

Return to query results.
Submit another query.