DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antdh and CG31549

DIOPT Version :9

Sequence 1:NP_572695.2 Gene:antdh / 32058 FlyBaseID:FBgn0026268 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster


Alignment Length:203 Identity:60/203 - (29%)
Similarity:100/203 - (49%) Gaps:11/203 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERWQNRVAVVTGASSGIGSAIAKDLVLAGMTVVGLARRVDRVKELQRELPAEKRGKLFALYCDV 65
            |..::::|.:|||||||||::.|..|...|..:|.:.|..:::||....:.|........|..|:
  Fly     1 MSSFKDKVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAGGATPLELQADM 65

  Fly    66 GNESSVNEAFDWIIQKLGAIDVLVNNAGTLQPGYLVDMNPAVMQQVLQTNIMGIVLCTQRAVRSM 130
            ..|:.|.:.....:.|.|.|||||||||.|:.|.:...:.....:::.||:..:...|..|...:
  Fly    66 TKEAEVQQIVGATLAKHGRIDVLVNNAGILETGSIEATSLEQFDRLMNTNVRSLYQLTMLATPEL 130

  Fly   131 RERKFDGHVVLINSILGHKTMTATEGVAPDVNVYPPSKHAVTALAEGYRQEFFGLGTRIKITSVS 195
            .:.|  |::|.::|:.|.:..       |.|..|..||.||.........|....|  :::.:|:
  Fly   131 VKTK--GNIVNVSSVCGLRAF-------PGVLAYNVSKAAVDQFTACIALELAPKG--VRVNAVN 184

  Fly   196 PGVVDTEI 203
            |||:.|:|
  Fly   185 PGVIVTDI 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antdhNP_572695.2 YdfG 1..250 CDD:226674 60/203 (30%)
NADB_Rossmann 1..245 CDD:304358 60/203 (30%)
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 59/200 (30%)
fabG 4..251 CDD:235975 59/200 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435098
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.