DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antdh and hsd17b1

DIOPT Version :9

Sequence 1:NP_572695.2 Gene:antdh / 32058 FlyBaseID:FBgn0026268 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_991147.2 Gene:hsd17b1 / 402842 ZFINID:ZDB-GENE-040901-5 Length:293 Species:Danio rerio


Alignment Length:268 Identity:63/268 - (23%)
Similarity:113/268 - (42%) Gaps:48/268 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QNRVAVVTGASSGIGSAIAKDLV---LAGMTVVGLARRVDRVKELQRELPAEKRGKLFALYCDVG 66
            :.:|.::||.|||||.::|..|.   .....|....|.:|:.:.|...:....:..|..|..||.
Zfish     2 EQKVVLITGCSSGIGLSLAVHLASNPAKAYKVYATMRNLDKKQRLLESVRGLHKDTLDILQMDVT 66

  Fly    67 NESSVNEAFDWIIQKLGAIDVLVNNAGTLQPGYLVDMNPAVMQQVLQTNIMGIVLCTQRAVRSMR 131
            ::.|:.:|...:.:  |.||:||.|||....|.|...:...::.:|..|::|.:...|..:..|:
Zfish    67 DQQSILDAQRNVSE--GRIDILVCNAGVGLMGPLETHSLDTIRAILDVNLLGTIRTIQTFLPDMK 129

  Fly   132 ERKFDGHVVLINSILGHKTMTATEGVAPDVNVYPPSKHAVTALAEGYR---QEFFGLGTRIKITS 193
            ::: .|.:::..|:.|.:.:...|       ||..||.|:....|...   |.|     .|.|:.
Zfish   130 KKR-HGRILVTGSMGGLQGLPFNE-------VYCASKFAIEGACESLAILLQHF-----NIHISL 181

  Fly   194 VSPGVVDTEIVPDSIREAIKDRMLH--------------------------SEDIAQGVLYAI-A 231
            :..|.|:|:.:.:..|....|::|.                          :|||.|..|.|: |
Zfish   182 IECGPVNTDFLMNLKRTEPGDKVLEVDAHTRSLYDQYLQHCQSVFQNAAQDTEDIIQVYLEAMEA 246

  Fly   232 TPPHVQVH 239
            ..|.::.:
Zfish   247 QTPFLRYY 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antdhNP_572695.2 YdfG 1..250 CDD:226674 63/268 (24%)
NADB_Rossmann 1..245 CDD:304358 63/268 (24%)
hsd17b1NP_991147.2 SDR 4..257 CDD:330230 63/266 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.