DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antdh and rdh8b

DIOPT Version :9

Sequence 1:NP_572695.2 Gene:antdh / 32058 FlyBaseID:FBgn0026268 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_957082.2 Gene:rdh8b / 393761 ZFINID:ZDB-GENE-040426-1759 Length:317 Species:Danio rerio


Alignment Length:210 Identity:61/210 - (29%)
Similarity:102/210 - (48%) Gaps:37/210 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVVTGASSGIGSAIAKDLVLAGMTVVGLARR-------VDRVKELQRE-----LPAEKRGKLF 59
            :|.::||.|||||..||          |.|||.       :..:::|:|:     ...:..||..
Zfish     7 KVVLITGCSSGIGLGIA----------VMLARDKQQRYYVIATMRDLKRQDKLVCAAGDTYGKTL 61

  Fly    60 ALYC--DVGNESSVNEAFDWIIQKLGAIDVLVNNAGTLQPGYLVDMNPAVMQQVLQTNIMGIVLC 122
            .: |  ||.:..||.:..|.:  |...||:|:||||....|.:..::...|.:|.:||..|.|..
Zfish    62 TV-CTLDVCSNESVRQCVDSV--KDRHIDILINNAGVGLVGPVEGLSLDDMMKVFETNFFGAVRM 123

  Fly   123 TQRAVRSMRERKFDGHVVLINSILGHKTMTATEGVAPDVNVYPPSKHAVTALAEGYRQEFFGLGT 187
            .:..:..|::|: .||:::|:|::|      .:|||.: :||..||.|:....|....:.  |..
Zfish   124 IKEVMPDMKKRR-SGHIIVISSVMG------LQGVAFN-DVYAASKFAIEGFCESLAVQL--LKF 178

  Fly   188 RIKITSVSPGVVDTE 202
            .:.::.:.||.|.||
Zfish   179 NVTMSMIEPGPVHTE 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antdhNP_572695.2 YdfG 1..250 CDD:226674 61/210 (29%)
NADB_Rossmann 1..245 CDD:304358 61/210 (29%)
rdh8bNP_957082.2 type1_17beta-HSD-like_SDR_c 7..264 CDD:187666 61/210 (29%)
adh_short 7..202 CDD:278532 61/210 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.