DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antdh and CG10672

DIOPT Version :9

Sequence 1:NP_572695.2 Gene:antdh / 32058 FlyBaseID:FBgn0026268 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster


Alignment Length:264 Identity:71/264 - (26%)
Similarity:120/264 - (45%) Gaps:30/264 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERWQNRVAVVTGASSGIGSAIAKDLVLAGMTVVGLARR---VDRVKELQRELPAEKRGKLFALY 62
            |:|...:|||||.::.|||.||||.|...|..||..:|:   ||......|:|.....|    |.
  Fly    66 MKRLAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAELRKLNLNVHG----LK 126

  Fly    63 CDVGNESSVNEAFDWIIQKLGAIDVLVNNAGTLQP--GYLVDMNPAVMQQVLQTNIMGIVLCTQR 125
            |.|.......:.|:..|.|.|.:::||:||.| .|  |.:::.:..|..::...|:....|..:.
  Fly   127 CHVSEPEDRKQLFEETISKFGKLNILVSNAAT-NPAVGGVLECDEKVWDKIFDVNVKSSYLLAKE 190

  Fly   126 AVRSMRERKFDGHVVLINSILGHKTMTATEGVAPDVNVYPPSKHAVTALAEGYRQEFFGLGTRIK 190
            |:..:|::| :..:|.::||.|:.....       :..|..||.|:..|.:...::....|  |:
  Fly   191 ALPLLRQQK-NSSIVFVSSIAGYDAFEL-------LGAYSVSKTALIGLTKAAAKDLAPEG--IR 245

  Fly   191 ITSVSPGVVDTEIVP-----DSIREAI-----KDRMLHSEDIAQGVLYAIATPPHVQVHELIIKP 245
            :..::|||:.|:...     :|..||.     ..|:..||::|..|.:.::........|.|:..
  Fly   246 VNCLAPGVIRTKFSKALYENESANEAALSKIPMGRLGTSEEMAGVVSFLVSEDAGYITGESIVAG 310

  Fly   246 LGET 249
            .|.|
  Fly   311 GGMT 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antdhNP_572695.2 YdfG 1..250 CDD:226674 71/264 (27%)
NADB_Rossmann 1..245 CDD:304358 69/258 (27%)
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 70/263 (27%)
fabG 67..316 CDD:235975 70/263 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435170
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.