DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antdh and dhs-6

DIOPT Version :9

Sequence 1:NP_572695.2 Gene:antdh / 32058 FlyBaseID:FBgn0026268 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001021972.1 Gene:dhs-6 / 3565470 WormBaseID:WBGene00000970 Length:418 Species:Caenorhabditis elegans


Alignment Length:238 Identity:62/238 - (26%)
Similarity:104/238 - (43%) Gaps:24/238 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RWQNRVAVVTGASSGIGSAIAKDLVLAGMTVVGLARRVDRVKELQREL--PAEK----RGKLFAL 61
            ::..|..::||||.|||..||..|...|..:|..|:......:|...:  .||:    .||....
 Worm     6 KFVGRTVLITGASRGIGKEIALKLAKDGANIVVAAKTATAHPKLPGTIYSAAEEIEKAGGKALPC 70

  Fly    62 YCDVGNESSVNEAFDWIIQKLGAIDVLVNNAGTLQPGYLVDMNPAVMQQ---VLQTNIMGIVLCT 123
            ..||.:|:||..:.:..::|.|.||:|:|||..:.   |.|.....|::   :...|..|..|.|
 Worm    71 IVDVRDEASVKASVEEAVKKFGGIDILINNASAIS---LTDTENTEMKRYDLMHSINTRGTFLMT 132

  Fly   124 QRAVRSMRERKFDGHVVLINSILGHKTMTATEGVAPDVNVYPPSKHAVTALAEGYRQEFFGLGTR 188
            :..:..::..| :.||:.|:..|..:|......||     |..:|:.::....|..:||...|..
 Worm   133 KTCLPYLKSGK-NPHVLNISPPLLMETRWFANHVA-----YTMAKYGMSMCVLGQHEEFRPHGIA 191

  Fly   189 IK----ITSVSPGVVDTEIVPDSIREAIKDRMLHSEDIAQGVL 227
            :.    :|::....:  |::.|...||...:.....|.|..||
 Worm   192 VNALWPLTAIWTAAM--EMLSDKGGEAGSRKPSIMADAAYAVL 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antdhNP_572695.2 YdfG 1..250 CDD:226674 62/238 (26%)
NADB_Rossmann 1..245 CDD:304358 62/238 (26%)
dhs-6NP_001021972.1 PRK08278 9..275 CDD:181349 62/235 (26%)
SCP2 319..411 CDD:376720
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156018
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.