DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antdh and sni

DIOPT Version :9

Sequence 1:NP_572695.2 Gene:antdh / 32058 FlyBaseID:FBgn0026268 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001285012.1 Gene:sni / 31761 FlyBaseID:FBgn0030026 Length:247 Species:Drosophila melanogaster


Alignment Length:235 Identity:58/235 - (24%)
Similarity:100/235 - (42%) Gaps:46/235 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVTGASSGIGSAIAKDLVLAGMTVVGL---ARRVDRVKELQRELPAEKRGKLFALYCDVGNESSV 71
            ::||.:.|:|..:.|.|:........|   .|..::.|||: :| |:....:..|..|:.|    
  Fly     5 LITGCNRGLGLGLVKALLNLPQPPQHLFTTCRNREQAKELE-DL-AKNHSNIHILEIDLRN---- 63

  Fly    72 NEAFDWIIQKLGAI------DVLVNNAGTLQPGYLVDMNPAVMQQ----VLQTN-IMGIVLC--- 122
            .:|:|.::..:..:      :||.||||.......:   .||..|    .|||| ::.|:|.   
  Fly    64 FDAYDKLVADIEGVTKDQGLNVLFNNAGIAPKSARI---TAVRSQELLDTLQTNTVVPIMLAKAC 125

  Fly   123 ---TQRAVRSMRERKFD-GHVVLIN--SILGHKTMTATEGVAPDVNVYPPSKHAVTALAEGYRQE 181
               .::|.::...:... |...:||  |||| .....|:|   .:..|..||.|:.|..:....:
  Fly   126 LPLLKKAAKANESQPMGVGRAAIINMSSILG-SIQGNTDG---GMYAYRTSKSALNAATKSLSVD 186

  Fly   182 FFGLGTRIKITSVSPGVVDTEI--------VPDSIREAIK 213
            .:  ..||...|:.||.|.|::        ||.|..:.::
  Fly   187 LY--PQRIMCVSLHPGWVKTDMGGSSAPLDVPTSTGQIVQ 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antdhNP_572695.2 YdfG 1..250 CDD:226674 58/235 (25%)
NADB_Rossmann 1..245 CDD:304358 58/235 (25%)
sniNP_001285012.1 carb_red_sniffer_like_SDR_c 4..247 CDD:187586 58/235 (25%)
adh_short 4..209 CDD:278532 55/218 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435178
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.