DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antdh and CG3699

DIOPT Version :9

Sequence 1:NP_572695.2 Gene:antdh / 32058 FlyBaseID:FBgn0026268 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster


Alignment Length:241 Identity:72/241 - (29%)
Similarity:114/241 - (47%) Gaps:38/241 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NRVAVVTGASSGIGSAIAKDLVLAGMTVVGLARRVDRVKELQRELPAEKRGKLFALYCDVGNESS 70
            |:|.:|||||||||:|||:.|...|.|:..:.|.|..::..::.|   |..:...:..||..:: 
  Fly     5 NKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSL---KGTQAEIVVADVTKDA- 65

  Fly    71 VNEAFDWIIQ----KLGAIDVLVNNAGTLQPGYLVDMNPAVMQQVLQTNIMGIVLCTQRAVRSMR 131
                 |.|:|    |.|.|||||||||.|..|.|:|::......||.||:.|::|.|:..:..:.
  Fly    66 -----DAIVQQTLAKFGRIDVLVNNAGILGKGGLIDLDIEEFDAVLNTNLRGVILLTKAVLPHLL 125

  Fly   132 ERKFDGHVVLINSILGHKTMTATEGVAPDVNVYPPSKHAVTALAEGYRQEFFGLGTRIKITSVSP 196
            :.|  |.||.::|..|.:.......       |..||.|:....:....|....|  :::.||:|
  Fly   126 KTK--GAVVNVSSCAGIRPFAGALS-------YGVSKAALDQFTKIVALEMAPQG--VRVNSVNP 179

  Fly   197 GVVDTEI-----VPDSIREAIKDRMLHSE---------DIAQGVLY 228
            |.|.|.|     :.|.....:..|.::|.         ::|:.|.:
  Fly   180 GFVVTNIHRNIGIVDEEYNGMLQRAINSHPMGRVGDVTEVAEAVAF 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antdhNP_572695.2 YdfG 1..250 CDD:226674 72/241 (30%)
NADB_Rossmann 1..245 CDD:304358 72/241 (30%)
CG3699NP_569875.2 fabG 1..244 CDD:235546 72/241 (30%)
NADB_Rossmann 3..248 CDD:304358 72/241 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435082
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.