DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antdh and Dhrs7c

DIOPT Version :9

Sequence 1:NP_572695.2 Gene:antdh / 32058 FlyBaseID:FBgn0026268 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001258527.1 Gene:Dhrs7c / 287411 RGDID:1306989 Length:311 Species:Rattus norvegicus


Alignment Length:196 Identity:50/196 - (25%)
Similarity:90/196 - (45%) Gaps:14/196 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QNRVAVVTGASSGIGSAIAKDLVLAGMTVVGLARRVDRVKELQRELPA-EKRGKLFA---LYCDV 65
            ||:|.|:|.|.||:|...|:.....|..:|...:..:.::.|...|.: ....|.|.   :..|:
  Rat    36 QNKVVVITDALSGLGKECARVFNAGGARLVLCGKNWEGLESLYAALTSVADPSKTFTPKLVLLDL 100

  Fly    66 GNESSVNEAFDWIIQKLGAIDVLVNNAGTLQPGYLVDMNPAVMQQVLQTNIMGIVLCTQRAVRSM 130
            .:.|.|.:....::...|.:|:|:|||.....|....::..:.::::..|..|.:..|:..:.:|
  Rat   101 SDISCVEDVAKEVLDCYGCVDILINNASVKVKGPAHKISLELDKKIMDANYFGPITFTKVLLPNM 165

  Fly   131 RERKFDGHVVLINSILGHKTMTATEGVAPDVNVYPPSKHAVTALAEGYRQEFFGLGTRIKITSVS 195
            ..|: .|.:||:|:|      .|..|: |....|..|||||....:..|.|.....  :.:::||
  Rat   166 ISRR-TGQIVLVNNI------QAKFGI-PFRTAYAASKHAVMGFFDCLRAEVEEYD--VVVSTVS 220

  Fly   196 P 196
            |
  Rat   221 P 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antdhNP_572695.2 YdfG 1..250 CDD:226674 50/196 (26%)
NADB_Rossmann 1..245 CDD:304358 50/196 (26%)
Dhrs7cNP_001258527.1 11beta-HSD1_like_SDR_c 35..296 CDD:187593 50/196 (26%)
PRK06181 37..293 CDD:235726 49/195 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.