DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antdh and Rdh8

DIOPT Version :9

Sequence 1:NP_572695.2 Gene:antdh / 32058 FlyBaseID:FBgn0026268 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001025461.1 Gene:Rdh8 / 235033 MGIID:2685028 Length:317 Species:Mus musculus


Alignment Length:274 Identity:80/274 - (29%)
Similarity:118/274 - (43%) Gaps:68/274 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QNRVAVVTGASSGIGSAIAKDL---------VLAGMTVVGLARRVDRVKELQRELPAEKRGK-LF 59
            |.|..:::|.|||||..:|..|         |:|.|..:|       .||.......|..|| |.
Mouse     4 QQRTVLISGCSSGIGLELALQLAHDPRQRYQVVATMRDLG-------KKEPLEAAAGEALGKTLS 61

  Fly    60 ALYCDVGNESSVNEAFDWIIQKLGAIDVLVNNAGTLQPGYLVDMNPAVMQQVLQTNIMGIVLCTQ 124
            .:..||.|:.||.:....|  :.|.:||||||||....|.|..::.|.||.|..||..|.|...:
Mouse    62 VVQLDVCNDESVTDCLSHI--EGGQVDVLVNNAGVGLVGPLEGLSLATMQSVFNTNFFGAVRLVK 124

  Fly   125 RAVRSMRERKFDGHVVLINSILGHKTMTATEGVAPDVNVYPPSKHAVTALAEGYRQEFFGLGTRI 189
            ..:..|:.|: .||:|:::|::|      .:||..: :||..||.|:    ||:   |..|..::
Mouse   125 AVLPGMKRRR-QGHIVVVSSVMG------LQGVMFN-DVYAASKFAL----EGF---FESLAIQL 174

  Fly   190 K-----ITSVSPGVVDTEIV----------------PDSI-----------REAIKDRMLHSEDI 222
            :     |:.|.||.|.|:..                ||::           ||..:.......|:
Mouse   175 RQFNIFISMVEPGPVTTDFEGKLLAQVSKAEFPDTDPDTLGYFRDLYLPASRELFRSVGQSPRDV 239

  Fly   223 AQGVLYAIAT--PP 234
            ||.:...|.|  ||
Mouse   240 AQVIAKVIGTTRPP 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antdhNP_572695.2 YdfG 1..250 CDD:226674 80/274 (29%)
NADB_Rossmann 1..245 CDD:304358 80/274 (29%)
Rdh8NP_001025461.1 NADB_Rossmann 6..263 CDD:304358 79/272 (29%)
adh_short 6..201 CDD:278532 68/218 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 1 Normalized mean entropy S3515
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.