DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antdh and DHRS7C

DIOPT Version :9

Sequence 1:NP_572695.2 Gene:antdh / 32058 FlyBaseID:FBgn0026268 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001207422.1 Gene:DHRS7C / 201140 HGNCID:32423 Length:312 Species:Homo sapiens


Alignment Length:241 Identity:56/241 - (23%)
Similarity:110/241 - (45%) Gaps:25/241 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QNRVAVVTGASSGIGSAIAKDLVLAGMTVVGLARRVDRVKELQREL-----PAEKRGKLFALYCD 64
            ||:|.|:|.|.||:|...|:.....|..:|...:..:|::.|...|     |:::......:..|
Human    36 QNKVVVITDAISGLGKECARVFHTGGARLVLCGKNWERLENLYDALISVADPSKQTFTPKLVLLD 100

  Fly    65 VGNESSVNEAFDWIIQKLGAIDVLVNNAGTLQPGYLVDMNPAVMQQVLQTNIMGIVLCTQRAVRS 129
            :.:.|.|.:....::...|.:|:|:|||.....|....::..:.::::..|..|.:..|:..:.:
Human   101 LSDISCVPDVAKEVLDCYGCVDILINNASVKVKGPAHKISLELDKKIMDANYFGPITLTKALLPN 165

  Fly   130 MRERKFDGHVVLINSILGHKTMTATEGVAPDVNVYPPSKHAVTALAEGYRQEFFGLGTRIKITSV 194
            |..|: .|.:||:|:|.|      ..|: |....|..||||.....:..|.|.....  :.|::|
Human   166 MISRR-TGQIVLVNNIQG------KFGI-PFRTTYAASKHAALGFFDCLRAEVEEYD--VVISTV 220

  Fly   195 SPGVVDT-EIVPD------SIREAIKDRM---LHSEDIAQGVLYAI 230
            ||..:.: .:.|:      ||.:....::   :|..::|:.|:..:
Human   221 SPTFIRSYHVYPEQGNWEASIWKFFFRKLTYGVHPVEVAEEVMRTV 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antdhNP_572695.2 YdfG 1..250 CDD:226674 56/241 (23%)
NADB_Rossmann 1..245 CDD:304358 56/241 (23%)
DHRS7CNP_001207422.1 11beta-HSD1_like_SDR_c 35..297 CDD:187593 56/241 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.