DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antdh and F20G2.1

DIOPT Version :9

Sequence 1:NP_572695.2 Gene:antdh / 32058 FlyBaseID:FBgn0026268 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_506406.1 Gene:F20G2.1 / 184742 WormBaseID:WBGene00008985 Length:249 Species:Caenorhabditis elegans


Alignment Length:249 Identity:56/249 - (22%)
Similarity:104/249 - (41%) Gaps:51/249 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVTGASSGIGSAIAKDLVLAG--MTVVGLARRVDRVKELQRELPAEKRGKLFALYCDVGNESSVN 72
            ::|||:.|||..:.|..:...  ..::|..|......||.    :.|..::..|..|:..:.|  
 Worm     7 LITGANRGIGLGLLKQFIKNKDVQIIIGTCRDPSNATELN----SIKDTRVHILQLDIDCDDS-- 65

  Fly    73 EAFDWIIQKLGA----------IDVLVNNAGTLQPGYLVD--MNPAVMQQVLQTNIMGIVLCTQR 125
                  |:||||          :.||:||||...| |.:|  .:.:.:.:.|:||.:..||.||.
 Worm    66 ------IRKLGAEVEKLVGEDGLTVLINNAGIFVP-YDIDGEKSRSTLIRQLETNTISTVLITQE 123

  Fly   126 AV----RSMRERKFDGHVVLINSILGHKTMTATEGVAPDVN--------VYPPSKHAVTALAEGY 178
            .:    |:..:.:.:|:.:..::|:   .:::|.|....::        .|..||.|:.:..:..
 Worm   124 LLPLLKRAAAKNRGEGYSINRSAII---NISSTAGSITKIDASYNIPLVAYRMSKSALNSFGKSC 185

  Fly   179 RQEFFGLGTRIKITSVSPGVVDTE-------IVPDSIREAIKDRMLHSEDIAQG 225
            ..:.  ....|.:|:..||.|.|:       :..|...:.:.|.:|...|...|
 Worm   186 SVDL--AKYHILVTTFCPGWVKTDMGGANGKLEIDDATKTLSDNILILGDAHHG 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antdhNP_572695.2 YdfG 1..250 CDD:226674 56/249 (22%)
NADB_Rossmann 1..245 CDD:304358 56/249 (22%)
F20G2.1NP_506406.1 adh_short 4..208 CDD:278532 51/218 (23%)
carb_red_sniffer_like_SDR_c 6..248 CDD:187586 56/249 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160155963
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.