DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antdh and dhs-12

DIOPT Version :9

Sequence 1:NP_572695.2 Gene:antdh / 32058 FlyBaseID:FBgn0026268 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_501850.1 Gene:dhs-12 / 177888 WormBaseID:WBGene00000975 Length:255 Species:Caenorhabditis elegans


Alignment Length:228 Identity:57/228 - (25%)
Similarity:105/228 - (46%) Gaps:30/228 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VTGASSGIGSAIAKDLV-LAGM-TVVGLARRVDRVKELQRELPAEKRGKLFALYCDVGNESSVNE 73
            :|||:.|||..:.::|: :.|: .:|..||.:|..||||....|:.|..|.|:  ||.|:.|:..
 Worm     8 ITGANRGIGLGLVRELLKVPGVEALVAGARNIDGAKELQSLAKADARLHLIAV--DVSNDGSLEN 70

  Fly    74 AFDWIIQKLG--AIDVLVNNAGTLQP-GYLVDMNPAVMQQVLQTNIMGIVLCTQRAVRSMRERKF 135
            :...:...:|  .:::|:||||.::. |.....|.|.:...:..|.:..:|.:|..:..:  :|.
 Worm    71 SVKSVSGIVGDRGLNLLINNAGLIESYGTTSAPNRASVLHCIDVNAVSALLASQHFLPLL--QKA 133

  Fly   136 DGHV------------VLINSILGHKTMTAT-EGVAPDVNVYPPSKHAVTALAEGYRQEFFGLGT 187
            ..||            |.|.|....:.:... .|.:..:..|..||.|:.:.:.....:|..|..
 Worm   134 ASHVSGDSLTPDRAAIVNIGSDCASQALNLRGSGPSNSLLAYKMSKVAMLSFSRSMAADFKRLEI 198

  Fly   188 RIKITSVSPGVVDTEI--------VPDSIREAI 212
            .:.||::.||.|.|::        |.:|:.:.:
 Worm   199 PVLITNIHPGWVQTDMGGSNAEISVDESVTKIV 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antdhNP_572695.2 YdfG 1..250 CDD:226674 57/228 (25%)
NADB_Rossmann 1..245 CDD:304358 57/228 (25%)
dhs-12NP_501850.1 adh_short 4..217 CDD:278532 55/212 (26%)
carb_red_sniffer_like_SDR_c 6..254 CDD:187586 57/228 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156000
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.