DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antdh and H04M03.3

DIOPT Version :9

Sequence 1:NP_572695.2 Gene:antdh / 32058 FlyBaseID:FBgn0026268 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_500885.1 Gene:H04M03.3 / 177359 WormBaseID:WBGene00019153 Length:333 Species:Caenorhabditis elegans


Alignment Length:223 Identity:46/223 - (20%)
Similarity:82/223 - (36%) Gaps:44/223 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVTGASSGIGSAIAKDLVLAGMTVVGLARRVDRVKELQRELPAEKRGKLFALYCDVGNESSVNEA 74
            ::||.:.|||...|..|......:....|..::.|::..:...:.......:..|:..|..|.:.
 Worm    53 LITGGTDGIGREAALKLAAEQHEITISGRDPNKAKDVIGQCQMKFNNTPRFIQTDLSLEHEVIKF 117

  Fly    75 FDWIIQKLGAIDVLVNNAGTL--QPGYLVDMNPAVMQQVLQTNIMGIVLCTQRAVRSMRERKFDG 137
            ...:.::  ..|:.:.|||.:  :||...:...|.|    .||::...:...:.:.|.|:.:...
 Worm   118 ASQVAEE--QFDICILNAGVMNPKPGRTREDREATM----MTNLVSSYMIAHKIIDSRRDDQRSL 176

  Fly   138 HVVLINSIL---------------GHKTMTATEGVAPDVNVYPPSKHAVTALAEGYRQEFFGLGT 187
            |.|...|||               ..|.....:.:.| .:|....|:|::.:         ||.|
 Worm   177 HFVFSTSILVKFHNATPLGIRFFNPEKVTDWQKSLVP-TDVSGAGKYAISKI---------GLAT 231

  Fly   188 -----------RIKITSVSPGVVDTEIV 204
                       .|..|||.||.|.|.|:
 Worm   232 LSTSISQCNLPNITATSVHPGTVYTNIM 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antdhNP_572695.2 YdfG 1..250 CDD:226674 46/223 (21%)
NADB_Rossmann 1..245 CDD:304358 46/223 (21%)
H04M03.3NP_500885.1 NADB_Rossmann 51..294 CDD:304358 46/223 (21%)
adh_short 52..264 CDD:278532 46/223 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43115
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.