Sequence 1: | NP_572695.2 | Gene: | antdh / 32058 | FlyBaseID: | FBgn0026268 | Length: | 250 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_500885.1 | Gene: | H04M03.3 / 177359 | WormBaseID: | WBGene00019153 | Length: | 333 | Species: | Caenorhabditis elegans |
Alignment Length: | 223 | Identity: | 46/223 - (20%) |
---|---|---|---|
Similarity: | 82/223 - (36%) | Gaps: | 44/223 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 VVTGASSGIGSAIAKDLVLAGMTVVGLARRVDRVKELQRELPAEKRGKLFALYCDVGNESSVNEA 74
Fly 75 FDWIIQKLGAIDVLVNNAGTL--QPGYLVDMNPAVMQQVLQTNIMGIVLCTQRAVRSMRERKFDG 137
Fly 138 HVVLINSIL---------------GHKTMTATEGVAPDVNVYPPSKHAVTALAEGYRQEFFGLGT 187
Fly 188 -----------RIKITSVSPGVVDTEIV 204 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
antdh | NP_572695.2 | YdfG | 1..250 | CDD:226674 | 46/223 (21%) |
NADB_Rossmann | 1..245 | CDD:304358 | 46/223 (21%) | ||
H04M03.3 | NP_500885.1 | NADB_Rossmann | 51..294 | CDD:304358 | 46/223 (21%) |
adh_short | 52..264 | CDD:278532 | 46/223 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR43115 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |