DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antdh and T25G12.13

DIOPT Version :9

Sequence 1:NP_572695.2 Gene:antdh / 32058 FlyBaseID:FBgn0026268 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001257285.1 Gene:T25G12.13 / 13224720 WormBaseID:WBGene00219274 Length:310 Species:Caenorhabditis elegans


Alignment Length:253 Identity:70/253 - (27%)
Similarity:112/253 - (44%) Gaps:44/253 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QNRVAVVTGASSGIGSAIAKDLVLAGMTVVGLARRVDRVKELQREL----PAEKRGKLFALYCDV 65
            :|::.|:||||||:|.::|.:|...|..|:.|||..:::||:..||    |..|....:..: |:
 Worm    45 KNKIVVITGASSGLGKSLAFELYKRGAQVILLARSTEKLKEICAELTKTFPLNKNKPTYYFF-DI 108

  Fly    66 GNESSVNEAFDWIIQKLGAIDVLVNNAGTLQPGYLVDMNPAVMQQVLQTNIMGIVLCTQRAVRSM 130
            .|....    .|  .::..:|||:||||....|...|...|:.::.::||:.|.|..||..:..:
 Worm   109 TNPDKA----PW--AQIPKVDVLINNAGMSNRGSCQDTTMAIHRKAMETNLFGHVQVTQSLLSKL 167

  Fly   131 RERKFDGHVVLINSILGHKTMTATEGVAPDVNVYPPSKHA----------------VTALAEGYR 179
            ..   ||.:|:.:||.|...:       |....|..||||                :..::.||.
 Worm   168 SP---DGCIVVTSSIQGKVAI-------PYRGSYSASKHALQGYFDCLRAEHKNLHILVVSAGYI 222

  Fly   180 QEFFG---LGTRIKITSVSPGVVDTEIVPD----SIREAIKDRMLHSEDIAQGVLYAI 230
            ...||   |.|..|:..|..........|:    .|.:||:||:...:....|..:||
 Worm   223 NTGFGSRALDTDGKVVGVEDENQKKGYSPEHSARMISDAIRDRVSDFDMAPFGARFAI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antdhNP_572695.2 YdfG 1..250 CDD:226674 70/253 (28%)
NADB_Rossmann 1..245 CDD:304358 70/253 (28%)
T25G12.13NP_001257285.1 NADB_Rossmann 44..290 CDD:304358 70/253 (28%)
PRK06181 46..289 CDD:235726 70/252 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.