DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlic and Dync2li1

DIOPT Version :9

Sequence 1:NP_572694.1 Gene:Dlic / 32057 FlyBaseID:FBgn0030276 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001382012.1 Gene:Dync2li1 / 298767 RGDID:1310286 Length:351 Species:Rattus norvegicus


Alignment Length:372 Identity:76/372 - (20%)
Similarity:140/372 - (37%) Gaps:75/372 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ENLWSAILNEVQ------TQGSTKLPSNKSVLVLGDNATGKTTLIAKLQGVEDPKKGS-GLEYAY 85
            |.||.....||:      :.|.......|||..:|....||||:|.:....::|.|.: .|||.|
  Rat     4 ETLWEIAKAEVEKRRCHGSDGDGMEIGEKSVFFIGSKNGGKTTIILRCLDRDEPAKPTLALEYTY 68

  Fly    86 IDVKDEYRDDMTRLGVWVLDGDPGHTNLLHYALNETNYAHTLVILTVSMTQP---WGWLEQLNHW 147
            ......:.........|.|.|.....:|:...:.........::|.:.:::|   |..:|.|   
  Rat    69 GRKTKGHNTPKDIAHFWELGGGTSLLDLISIPITVDTLRTFSIVLVLDLSKPNDLWPTMENL--- 130

  Fly   148 IKVLGQHIDSLQL-----DAKEKEAARQRLTTTWQSYCEVGDDLDPGSPVKRTMRNNSIDEDDLL 207
            ::....|:|.:.:     ::|.....|||:   |.                 .|:.:..|.:   
  Rat   131 LQATKSHVDKVTMKLGKANSKASSEMRQRM---WS-----------------VMQKDHPDRE--- 172

  Fly   208 PLTEDALITNLGLDIVVVVTKTDYMTTLEKEYEYRDEHFDFIQQWIRNFCLRHGTSLFYTSVKED 272
                  ||....:.:|::.:|.|..      .::..|....|.:.:|.....:|.||.:||..| 
  Rat   173 ------LIDPFPIPLVIIGSKYDIF------QDFDPEKRKVICKTLRFVAHYYGASLMFTSKSE- 224

  Fly   273 KNCDVLYK---YLTHRIYGLPFRTPALVVEKDAVLIPAGWDSLKKIS---ILYENMHGVKAENP- 330
               .:|.|   .:....:|:.......|.:...:.|.||.|||.:|.   :...::..::|.:| 
  Rat   225 ---ALLLKMRGVINQLAFGIDKSKSMCVDQNKPLFITAGLDSLCQIGSPPVPDSDIGKLQAHSPM 286

  Fly   331 ------YTDII--KSPPTRKAVSNREAEVQ---TEDEQAFLARQQEI 366
                  |..:.  ||..|.||:.:...:.|   :|.::..:.:.||:
  Rat   287 ELWKKVYEKLFPPKSTSTLKAIQDPARDPQYAESEVDEMRVQKDQEL 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DlicNP_572694.1 DLIC 25..493 CDD:283447 76/372 (20%)
ABC_ATPase 43..>79 CDD:213179 11/35 (31%)
Dync2li1NP_001382012.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 304..335 7/30 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.