DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlic and dil1

DIOPT Version :9

Sequence 1:NP_572694.1 Gene:Dlic / 32057 FlyBaseID:FBgn0030276 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_594698.2 Gene:dil1 / 2543586 PomBaseID:SPAC458.04c Length:360 Species:Schizosaccharomyces pombe


Alignment Length:404 Identity:87/404 - (21%)
Similarity:150/404 - (37%) Gaps:104/404 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ENLWSAILNEVQTQGSTKLPSNKSVLVLGDNATGKTTLIAKLQGVEDPKKGSGLEYAY------- 85
            :.|...:||:::    .|.|...|::.:|::       :..:|.:.:....||..|:.       
pombe     2 DELLEKLLNDLK----KKEPKACSIICIGED-------LDIIQCMNEHGCFSGGSYSELSNDCET 55

  Fly    86 -----IDVKDEYRDDMTRLGVWVLDGDPG--HTNLLHYALNETNYAHTLVILTVSMTQPWGWLEQ 143
                 |..|..:..|..::..|.:....|  ...|:..||||    |.|.:|         |:  
pombe    56 VNFRGIAYKCFFTKDQVKVNFWQISHLTGGLFNFLVSQALNE----HGLDLL---------WI-- 105

  Fly   144 LNHWIKVLGQHIDSL-QLDAKEKEAARQRLTTTWQSYCEVGDDLDPGSPVKRTMRNNSIDEDD-- 205
                |.|:.|.:.:| ....|.....|...|....:              :.|:||...:..:  
pombe   106 ----IMVVAQTLSALVSFPEKLLNILRNMKTILINT--------------EETVRNRFEESQNKK 152

  Fly   206 ---LLPLTEDALITNLG--LDIVVVVTKTDYMTTLEKEYEYRDEHFDFIQQWIRNFCLRHGTSLF 265
               ||......|..:.|  |:..||:.:..:...|....   |...:||.|::|...|...||..
pombe   153 LVALLDKNSTTLDISSGILLNFTVVLKQLKHALGLHTSV---DNSQEFILQFLRTTLLSVPTSSI 214

  Fly   266 YTSVKED----KNCDVLYKY--LTHRIYGLPFRTPALVVEKDAVLIPAGWDSLKKI-SILYE-NM 322
             .|:..|    .|.:||.||  :..:.....|.  |..::.:.:.||..||::.|| |:.:| |:
pombe   215 -VSISADPTSWNNLNVLMKYNFMFQKFKPRDFH--AQTIQSETMFIPPCWDTISKIQSVNHEFNI 276

  Fly   323 HGVK--AENPY--TDII-------KSPPTRKAVSNR--EAEVQTEDEQAFLARQQEILKQGDQVR 374
            ...|  |:|.|  .||.       ||.......|::  :.::..:..|.||   ||:..:..:::
pombe   277 ALFKQTAKNFYDTLDISLLLGLFDKSISMLNCHSSKISDGDIPYKSHQVFL---QELQNKYSEIK 338

  Fly   375 GESPLRSQGVGSNK 388
            ..|        |||
pombe   339 TYS--------SNK 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DlicNP_572694.1 DLIC 25..493 CDD:283447 87/404 (22%)
ABC_ATPase 43..>79 CDD:213179 5/35 (14%)
dil1NP_594698.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12688
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.