DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlic and AgaP_AGAP002589

DIOPT Version :9

Sequence 1:NP_572694.1 Gene:Dlic / 32057 FlyBaseID:FBgn0030276 Length:493 Species:Drosophila melanogaster
Sequence 2:XP_312349.5 Gene:AgaP_AGAP002589 / 1273382 VectorBaseID:AGAP002589 Length:261 Species:Anopheles gambiae


Alignment Length:294 Identity:137/294 - (46%)
Similarity:189/294 - (64%) Gaps:40/294 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 WSAILNEVQTQGSTKLPSNKSVLVLGDNATGKTTLIAKLQGVEDPKKGSGLEYAYIDVKDEYRDD 95
            |:.:|.|.|::.:||:|||||:.||||.:...:||||||:|........                
Mosquito     6 WTTLLGEYQSRKATKMPSNKSMFVLGDTSCDSSTLIAKLKGCNATTAQQ---------------- 54

  Fly    96 MTRLGVWVLDGDPGHTNLLHYALNETNYAHTLVILTVSMTQPWGWLEQLNHWIKVLGQHIDSLQL 160
                    |:|      ||.:||||.::.|||::||:||..||.|::||.:|:|||..||..|::
Mosquito    55 --------LNG------LLKFALNERSFPHTLILLTLSMAAPWNWMDQLQYWMKVLDNHIGGLEI 105

  Fly   161 DAKEKEAARQRLTTTWQSYCEVGDDLDPGSPVKRTMRNNSIDEDDLLPL-TEDALIT-NLGLDIV 223
            ||:.|.....||...||||.::|.|....||.||:        ::|:|| .|||::| |||::::
Mosquito   106 DAELKHQCMARLMAKWQSYSDLGSDPLRNSPCKRS--------NELVPLPLEDAVLTSNLGMEVI 162

  Fly   224 VVVTKTDYMTTLEKEYEYRDEHFDFIQQWIRNFCLRHGTSLFYTSVKEDKNCDVLYKYLTHRIYG 288
            |||.::|.|.||.:|..||:|||||:||.||...|::|.||.||:||.:.|||:|.:||.|||||
Mosquito   163 VVVKRSDQMATLRRELNYREEHFDFMQQAIRRAGLQYGASLVYTTVKNNINCDLLLQYLKHRIYG 227

  Fly   289 LPFRTPALVVEKDAVLIPAGWDSLKKISILYENM 322
            |||.|.|.|||||||.:||||||::|||||||::
Mosquito   228 LPFGTSASVVEKDAVFVPAGWDSVQKISILYESL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DlicNP_572694.1 DLIC 25..493 CDD:283447 137/294 (47%)
ABC_ATPase 43..>79 CDD:213179 18/35 (51%)
AgaP_AGAP002589XP_312349.5 DLIC 6..>261 CDD:283447 137/292 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3905
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1299592at2759
OrthoFinder 1 1.000 - - FOG0003091
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12688
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2062
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.