DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlic and dync2li1

DIOPT Version :9

Sequence 1:NP_572694.1 Gene:Dlic / 32057 FlyBaseID:FBgn0030276 Length:493 Species:Drosophila melanogaster
Sequence 2:XP_004914814.1 Gene:dync2li1 / 101734949 XenbaseID:XB-GENE-981659 Length:359 Species:Xenopus tropicalis


Alignment Length:306 Identity:69/306 - (22%)
Similarity:119/306 - (38%) Gaps:57/306 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ENLWSAILNEVQTQ-----GSTKLPSN--KSVLVLGDNATGKTTLIAK-LQGVEDPKKGSGLEYA 84
            :|||...::|||.:     |:.::..|  :||..:|:...||||.|.: |...|.||....|||.
 Frog     6 DNLWDIAISEVQQKENAGDGNEEVEENSERSVFFIGNKNGGKTTTILRCLDRDEAPKPTLALEYT 70

  Fly    85 YIDVKDEYRDDMTRLGVWVLDGDPGHTNLLHYALNETNYAHTLVILTVSMTQP---WGWLEQLNH 146
            :......:.........|.|.|.....:|:...:...|.....|:|.:.:::|   |..:|.|  
 Frog    71 FGRRAKGHNTPKDIAHFWELGGGTSLLDLIQIPITSDNLMSFSVVLVLDLSKPNELWPTMESL-- 133

  Fly   147 WIKVLGQHIDSL-----QLDAKEKEAARQRLTTTWQSYCEVGDDLDPGSPVKRTMRNNSIDEDDL 206
             ::...:|:|.:     :..:|.....:|:|   ||                 |:..:..|.:  
 Frog   134 -LETTRKHVDKIITGIAKNSSKIANQIKQKL---WQ-----------------TIPKDHPDRE-- 175

  Fly   207 LPLTEDALITNLGLDIVVVVTKTDYMTTLEKEYEYRDEHFDFIQQWIRNFCLRHGTSLFYTSVKE 271
                   ||....|.:::..:|.|.....:.|..      ..|.:.:|.....:|.||.:|| |.
 Frog   176 -------LIDPFPLPLLIAGSKYDIFQDFDSEIR------KIICKTLRFVAHYYGASLLFTS-KS 226

  Fly   272 DKNC--DVLYKYLTHRIYGLPFRTPALVVEKDAVLIPAGWDSLKKI 315
            |...  .|...::.|..:||.......:.....::||||.||..:|
 Frog   227 DALMLKGVTRSFINHLAFGLDKSKSLSIDHNKPLIIPAGSDSFSQI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DlicNP_572694.1 DLIC 25..493 CDD:283447 69/306 (23%)
ABC_ATPase 43..>79 CDD:213179 13/38 (34%)
dync2li1XP_004914814.1 DLIC 5..>273 CDD:368612 69/306 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.